KEGG   Drosophila ananassae: Dana_GF20891Help
Entry
Dana_GF20891      CDS       T01059                                 

Definition
GF20891 gene product from transcript GF20891-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dan  Drosophila ananassae
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dana_GF20891
Enzymes [BR:dan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dana_GF20891
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dana_GF20891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MATTSIEGYKLGKILIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLEGKAEISN
ATNGQVFRLLNEAGIRTAYVKQCGSKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVPEG
YRFSPPKQETFFKDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMRRTTLLVFEILER
AWQTRDCALIDMKVEFGIDADGNIVLADIIDSDSWRLWPSGDKRLMVDKQVYRNLTAVTA
SDLDTVKRNFIWVSQQLADIIPKKDHLVVVLMGSASDTSHSEKIATSCRSLGLNVELRVT
SAHKGPEETLRIVREYESVMQNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQV
DVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFVTLKKADKEL
RGVRNA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacatccattgagggctataaactgggcaagatcctaatcgagggcaagacc
aagcaggtctacgatcttcccgaacagccaggactctgtctgcttctcagcaaggaccgg
attaccgccggggatggcgtcaaggcccatgatctggagggcaaggccgagatctccaac
gccaccaacggacaggtcttccgcctcctcaacgaagcaggtattcgcaccgcctatgtg
aagcagtgtggctcgaaggccttcatcgcccgcaaatgtcaaatgatacccattgagtgg
gtaacccgacgcctcgccaccggatctttcctcaaacggaacgtgggcgtaccggagggc
tatagattctctcctcccaaacaggagactttcttcaaggacgatgccaaccacgatccc
caatggagcgaagagcagatcgtctccgccaagttcgagctcaatggcctggttatcggt
caagatgaagtcgatattatgcgcaggaccaccctcctggtctttgagatcctggagagg
gcgtggcagaccagggactgcgccctcatcgacatgaaggtggagttcggcatcgatgcc
gatggaaacatagtcctggccgacatcatcgactccgattcgtggcgcctttggccctcg
ggcgacaagcgactgatggtcgacaagcaggtctaccggaatctcacagccgtaaccgcc
agcgatctggacaccgtgaagcgtaacttcatctgggtgtcccagcagttggccgacatt
atccccaaaaaggatcatctcgtggtcgtcctgatgggcagtgcctcggacacctcgcac
agcgaaaagatcgccaccagctgtcggtctctgggactgaatgtggagctccgggtgacc
tccgcccacaagggacccgaggagacactccgcatagtccgggagtacgagtccgtgatg
cagaatctgatattcgtggcggtggccggacgttccaacggtctgggccctgtggtgtcc
ggcagcaccaactatccggtcatcaactgccctcccgtcaagtccgacaacatgcaggtg
gatgtctggagcagcctgaacctgccctccggcctgggatgtgccaccgtcctgtatccg
gaggcggcggccctgcatgctgccactatcctgggactcggcaacttcatggtgtggtcc
aagctgagggtcaaggccctcaacaacttcgtcaccctcaagaaggccgacaaggagctc
cgtggtgtccgaaatgcctag

DBGET integrated database retrieval system