KEGG   Drosophila ananassae: Dana_GF20891Help
Entry
Dana_GF20891      CDS       T01059                                 

Definition
GF20891 gene product from transcript GF20891-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dan  Drosophila ananassae
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dan00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 426 aa AA seqDB search
MATTSIEGYKLGKILIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLEGKAEISN
ATNGQVFRLLNEAGIRTAYVKQCGSKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVPEG
YRFSPPKQETFFKDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMRRTTLLVFEILER
AWQTRDCALIDMKVEFGIDADGNIVLADIIDSDSWRLWPSGDKRLMVDKQVYRNLTAVTA
SDLDTVKRNFIWVSQQLADIIPKKDHLVVVLMGSASDTSHSEKIATSCRSLGLNVELRVT
SAHKGPEETLRIVREYESVMQNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQV
DVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFVTLKKADKEL
RGVRNA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacatccattgagggctataaactgggcaagatcctaatcgagggcaagacc
aagcaggtctacgatcttcccgaacagccaggactctgtctgcttctcagcaaggaccgg
attaccgccggggatggcgtcaaggcccatgatctggagggcaaggccgagatctccaac
gccaccaacggacaggtcttccgcctcctcaacgaagcaggtattcgcaccgcctatgtg
aagcagtgtggctcgaaggccttcatcgcccgcaaatgtcaaatgatacccattgagtgg
gtaacccgacgcctcgccaccggatctttcctcaaacggaacgtgggcgtaccggagggc
tatagattctctcctcccaaacaggagactttcttcaaggacgatgccaaccacgatccc
caatggagcgaagagcagatcgtctccgccaagttcgagctcaatggcctggttatcggt
caagatgaagtcgatattatgcgcaggaccaccctcctggtctttgagatcctggagagg
gcgtggcagaccagggactgcgccctcatcgacatgaaggtggagttcggcatcgatgcc
gatggaaacatagtcctggccgacatcatcgactccgattcgtggcgcctttggccctcg
ggcgacaagcgactgatggtcgacaagcaggtctaccggaatctcacagccgtaaccgcc
agcgatctggacaccgtgaagcgtaacttcatctgggtgtcccagcagttggccgacatt
atccccaaaaaggatcatctcgtggtcgtcctgatgggcagtgcctcggacacctcgcac
agcgaaaagatcgccaccagctgtcggtctctgggactgaatgtggagctccgggtgacc
tccgcccacaagggacccgaggagacactccgcatagtccgggagtacgagtccgtgatg
cagaatctgatattcgtggcggtggccggacgttccaacggtctgggccctgtggtgtcc
ggcagcaccaactatccggtcatcaactgccctcccgtcaagtccgacaacatgcaggtg
gatgtctggagcagcctgaacctgccctccggcctgggatgtgccaccgtcctgtatccg
gaggcggcggccctgcatgctgccactatcctgggactcggcaacttcatggtgtggtcc
aagctgagggtcaaggccctcaacaacttcgtcaccctcaagaaggccgacaaggagctc
cgtggtgtccgaaatgcctag

DBGET integrated database retrieval system