KEGG   Drosophila ananassae: Dana_GF20991Help
Entry
Dana_GF20991      CDS       T01059                                 

Definition
GF20991 gene product from transcript GF20991-RA
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dan  Drosophila ananassae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF20991
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF20991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1514 aa AA seqDB search
MDVLELLRASATGSYTALFSDAWCQYVSKQITNSMYLYCALGVLSMVFLAWFMYFKRLAR
IRLRDEASRSMSAVNSSSGGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKR
RAVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIDGSDRVPPDALYMLQSIRIFGHFE
KPVFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKG
ESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMEAFEEVFQDNPDVMIRVIQVIM
IRLQRVLFTALRNYLGLNAELVQNHMRFKSSTIMAPSTHSSQCSRQTGSQPTLGVPAPTC
SNTTTTASPTTANTVHSGLAGANGVIGQSRPPISPSRHSREEHTLSDPNPNPDVINTSVG
GASGTSMYAEVHGDAPNVDVFHQQQHSVGNLSTRRGSISQMAPDLGPALSQPGLGQGQGL
GPGVTGAPPLMTGAPASKIDMRLVHASAVDSLRKELGLPEEDSHIIEPFVEVRELEPNVT
LITEGNSDDVCVWFVMTGTLAVYQANQDAARAKQQQEKNDMLIHFVHPGEIVGGLAMLTG
EASAYTIRSRNNSRVAFIRRAAIYQIMRQRPRIVLDLGNGVVRRLSPLVRQCDYALDWIF
LESGRAVYRQDEISDSTYIVLSGRMRSVITHPGGKKEIIGEYGKGDLVGIVEMITETSRT
TTVLAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLGTMQTRSSSAAPGGPVEA
NPVTHKYSTVALVPITDEVPLTPFTYELYHSLCAIGPVLRLTSDVVRKQLGPNIFEAANE
YRLTSWLAQQEDRNIITLYQCDNALSAWTQRCMRQADVILIVGLGNGSHLVGKFEREIDR
LAMRTQKELVLLYPETTNSKPANTLSWLNARPWVTKHHHVLCVKRIFTRKSQYRINDLYS
RVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGMLKAIQEAGIPIDMVGGVS
IGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPITSMFSGREFNKTIHDTF
GDVSIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLSGYMPPLCDPKDGHLLLD
GGYVNNLPGQLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHII
AIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTSPVKVPDLPDIQSRLAYVSCVRQLEEV
KNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYVFGKNYFENMAKAGRLGRFNQWFNKEPP
KRGNHASLNEYTFIDLAQIVCRLPETNAGNSADIFSEDEDCDGYISEPTTLNTDRRRIQV
PRAGNSLSFSENEMDSDVELDLQLDRKTEKSIHSAATSVARGSMRSREFHKLEQDRSVEI
TRLKDETERIMAPTNLDRKGDGQEQEKEPEQEQELETEEPNQENTEVEEEQRNQGEGNED
NKENKGGAYNETKN
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaactcctgcgcgccagcgccaccggcagctacacggctctcttttcg
gatgcctggtgccagtacgtttccaagcagatcactaactcgatgtacctgtattgcgcc
ctgggcgtgctgtcgatggtgttcctggcgtggttcatgtacttcaagcgcctggcccgc
atccggctacgagacgaggcatcccgctccatgagcgccgttaactcctcgtctggaggg
gacctgcgcggcctcaggttccggaagcgggacaagatgctcttctacggccggcggatg
ctgcgcaagatgaagaacgtcagcggccagatgtacagcagcggcaagggctacaagcgg
agagccgtgatgcgcttcgcccgacgcatccttcagctgagacgcgacaacatgccgctg
gagatgcgcaccgtggagccgccggccgagtatctggaggagacgatcgacggcagtgat
agggtgccaccggatgccctctacatgctgcagagcatccgcatcttcggccacttcgag
aagcccgtcttcctgcggctctgcaagcacacgcagctcctcgagctgatggccggcgac
tatctcttcaagatcaccgatccggacgacagtgtctacatcgttcagtcgggcatgatc
aatgtgtacatctcgaatgcggacgggagcacgctatccctgaagacggtgcgcaaggga
gagtcggtaacgtcgctgctgagcttcatcgatgtcctgtctgggaatcccagctactac
aaaacggtgacagcgaaggcgatagagaagtccgtggtgatacggctgcccatggaggcc
ttcgaggaggttttccaggacaacccggacgtgatgattcgcgtcattcaggtgatcatg
atccgcctgcagcgcgtgctcttcaccgctctgaggaactacctcggcctgaacgccgag
ctggtgcagaatcacatgcgtttcaagagcagcaccataatggcgccgtccacccactcc
tcgcagtgttcgcgccagactggctcccagccgacactcggcgtacccgctccaacgtgc
tcgaacaccaccaccacggcctcgccgacgaccgccaatacggtgcattccggtttggca
ggtgctaatggcgtcattggtcagagccggccacccatctcgccttcccgccactcgcgg
gaggagcataccctatccgatcccaatcccaacccggatgtgataaacaccagcgtcggc
ggcgcctccggcaccagcatgtacgccgaggtgcacggcgatgcgcccaacgtggacgtg
ttccatcagcagcagcactccgtgggcaatctgtcgacgcgacgcggttccatctcccaa
atggctcccgatttggggccggccctgtcccagcccggactggggcaaggtcagggcctg
ggacccggtgtgacgggagctcccccgctgatgaccggagcacccgcgtccaagatagac
atgcgactggtgcatgcctccgctgtggacagcctgcgcaaggagctgggcctgcccgag
gaggactcccacatcattgagccgttcgtggaggtgcgagaactggaaccgaatgtcacc
ctcatcacggagggcaactcggacgatgtgtgcgtgtggttcgtgatgaccggcactctg
gccgtctaccaggccaaccaggacgcggcgcgggcgaagcagcagcaggagaagaacgac
atgctcatccactttgtccatccgggcgagattgtcggcggattggccatgctgacgggc
gaggccagtgcctataccatccgctccaggaacaacagcagggtggccttcatccgccgt
gcggctatttatcagatcatgcggcagagaccccgcatcgtgctggatctgggcaatgga
gtggtgcgtcggctttcgcctctggtgcggcagtgtgactacgccctcgattggatcttc
ctggagtcgggacgagccgtgtaccggcaggacgagatcagcgacagcacctacattgtt
ctgagcggacgaatgcgatctgtgattacgcatcccggtggcaagaaggagatcatcggc
gagtacggcaagggtgacctggttggcatcgtcgagatgatcaccgagacgtcgcgcacc
accaccgtgctggccgtgcgcgactcggagctggccaagctgcccgagggcctgttcaat
gccatcaagctgcgctaccccattgtggtaacgaagctgattagcttcctcagccaccgc
ttcctcggcacgatgcagacgcgctccagcagcgcggcgccaggtggacccgtcgaggcc
aatcccgtcacgcacaagtactccacggtggctctcgtgcccattacggacgaggtgccg
ctgacgcccttcacctacgagctctaccactcactttgtgccataggtcccgtcctccgt
ttaacctccgatgtggtgcgcaaacagctgggccccaacatttttgaggctgccaacgaa
taccgactgacctcgtggctggcgcagcaggaggaccggaacatcatcaccctgtaccag
tgcgacaatgcgctgagtgcctggacacagcgctgcatgcggcaggcggacgtcatcctg
atcgtgggcctgggcaacggctcccatttggtgggcaagttcgagcgcgagatcgatcgg
ctggcgatgcgaacacagaaggagctggtgctgctctaccccgagacgacgaactccaag
ccggctaacacgctcagctggctgaatgccaggccctgggtaacgaagcaccaccacgtg
ctctgcgtgaagcgcatcttcacccgcaagagccaataccgcattaatgatctctatagt
cgcgtcctgctctcggagccgaacatgcattccgacttctcgcgcctcgcccgctggctg
actggtaactccattggcctggtcctgggcgggggtggagctcgcggtgcggcccatatc
ggaatgctgaaggccatccaggaggcgggtatacccatcgacatggtgggcggcgtcagc
atcggtgccctgatgggagcgctctggtgttcggagcgcaacatcaccacagtgactcag
aaggcgcgagagtggtcaaagaaaatgacaaaatggttcctacaactgctggacctcacc
tacccgatcacctcgatgttttccggacgggagttcaacaagaccatccacgacaccttt
ggggacgtgagcatcgaggacttgtggataccctacttcaccctcaccaccgacatcacg
gccagctgccatcgcattcacaccaatggatctctgtggcgttacgtacgctcctccatg
tcgctcagcggctatatgccaccactgtgcgatccaaaagatggacacctcctgctggat
ggcggctatgtgaataatttgccaggtcagctgtggcgatactgccgcgccagcatgtcc
attgccggcgtcttcccgcccttctgcgactatcgcgacggccacctgctcctcgacggc
tgctacacgaacaatgtgccagccgatgtgatgcacaacctgggcgccgctcatattatc
gccatcgatgtgggatcccaggacgacaccgatctgaccaactacggggacgacctaagt
ggctggtggctgctctacaagaagtggaatccattcacctcgccagtgaaggtgcccgat
ctgccggacattcagtcccgacttgcctatgtgtcgtgcgtccgccagttggaggaggta
aagaactcggactactgtgaatatatcaggcccccgattgacaagtacaagactctggca
tttggcagcttcgacgagatccgggacgtgggctacgtctttggcaagaactacttcgag
aacatggccaaggccgggcgactgggtcgcttcaaccaatggttcaataaggagccgccg
aagcgcggcaaccacgcctccctcaatgagtacaccttcatcgatctggcccagatcgtg
tgccgtctgccggagacgaatgccggcaactcggcggacatattcagcgaggacgaagac
tgtgatggatatatttcggagccgacaacgcttaatacggatcgacggcgcatccaagtg
ccacgtgccggcaattcgttgtcgttttccgagaacgaaatggactcggatgtggagctg
gatctgcagctggatcgaaaaacggaaaagtctatacactccgctgccacgtcggtggcg
agaggcagcatgcgttccagggaatttcataagctggaacaggatcggagtgtggagatc
acgaggctcaaggacgagactgaacgcattatggcgccaacgaatctggaccggaaaggg
gatggtcaggagcaggaaaaggaaccggaacaggagcaggaactggagacagaagaaccg
aaccaagagaataccgaagtagaggaggagcaacggaatcaaggcgaaggaaacgaagac
aacaaggagaacaagggaggcgcgtataacgaaaccaaaaactag

DBGET integrated database retrieval system