KEGG   Drosophila ananassae: Dana_GF21001Help
Entry
Dana_GF21001      CDS       T01059                                 

Definition
GF21001 gene product from transcript GF21001-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF21001
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF21001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1296 aa AA seqDB search
MRVIAPRRSSTSAAGSGSLYGTSSAGGATGSSSASTSGSGAADRSSITTNGYSRYSSNYD
RSSKWLPPSGSSSAGTSSSSSGYGSSYYPSSYSTYSSSHTSGSSSYTPRSSLQRSSVGSS
SSSSSYLNGGAGSSSSAYRTSSSYLSNYDSPTYSRYGLSRKTGSKVASSNGDSLSSSGGS
TRRVGADDYGSIRRGETAKKPPPSGGTTSSSNSNSNSNSGESNNGHTPNTKRLSSSSSSP
SLARLVATSGLDIYEKYSPANYKPNCDLSRSRSALAEPDVENGSSSSDAPTTTVTLDRPR
SSRYSRLYSSGSDAGTGEREASSSRLGSGKFTLSNSSSSGDVPTATFTLRSSRTRRNAED
TTVAPAAAAPPPPPPPPPPPASTSNGHRSAESNGLEAKLNGLSLLSSSPKRNAIYESRSG
SSLRNLDTTDDSGVGAAGASKAEDSNGDVTATATFKLGDGSSKQQQQQQQLQSQPQQSHK
LHKLKPIHGSCNNNSGTPVSVSIMNGHSTATTNNNNNSGGLNSSNNAINNNMQRQQHHHH
HQQQQQHDDISYIDSDEPASGSAGAVAGTGLASSGGAGAGTGGIKSSICYFKPITPPQLR
HHHQQREQRRGDDQETQAGNGKRYARPKSTIIASAHSNFAANYEKFNNYRQTNGTSDHAA
GSEPRHSAGGGGGGVGNPSSNARRYGIDSLSIKASIEKFNNLSGQKQRQATPAPVQGAGS
RAGSSGSSAASGRSSQNIGSSSGNLQQRFSSDLDNVRVAAGYSSSLTRTPYRTTTSVGQA
APPTAAGSGIGSTAVVTPMSKVTMRGAHAHSSNRQAADCEAMTKVTNNDNAATATPAAAV
AATPPPPPPHQPSATSSVSTTATATASSTVPDTSTAPASGPVSAAATAAAAGDSTQARSV
TGSSGSARSVLPPVSPTSSRYWDHDRDGTTSRSTVGSTSSALTSSSLKHSTDDGYKSAAS
ATREEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSSSTKDQQILHEFA
KLIQEMWTSNVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGE
TLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLS
VPLPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKR
FSETRWSKLSNIVEFPTMDRELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKH
PVSRKWHEFNDNIVSDALSENFLVSSSAYILFYERA
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaattgcgccgcgtagatcgtcaacgtcagcggcgggcagcggcagtctatac
ggcacatcgtcggccggcggcgccaccggcagcagcagcgcctccaccagcggcagcggt
gcggcggacagaagcagcatcaccacgaacggctactcacgctactcgtccaactacgat
cgcagcagcaagtggctgcccccgtccggcagctcctcggccggcacttcctcgtcctcg
tccggctacggcagtagctactaccccagctcctattcaacgtactcctccagccacacc
agcggctcctcgtcgtacacgccccgctccagcctgcagaggagcagcgtcgggtccagc
agctcatcgtcctcgtacttgaacggaggagccggctccagttcgtccgcctaccgcacc
agctcctcgtacttgagcaactatgattcacctacgtacagccgatacggactatcgcga
aaaactggaagcaaggttgcatcatcgaatggcgacagcttgagctcgagtggtggatcc
accaggagggtgggggccgatgactatggcagcatccggcgcggggagaccgccaagaag
ccaccgcccagtggaggcaccacctccagttcaaactcgaactccaattcgaacagcggt
gagagcaacaacggccacaccccaaacacgaaaagactctccagctcatcctcatctccg
tcgctggcccgcctggtggccacctccggattggacatctacgaaaagtacagtccggcc
aactataaacccaactgtgacctgtcacgttccaggtcggctcttgctgagccggatgtc
gagaatggcagcagcagcagcgacgcacccaccaccacagtgaccctggatcggccccgg
agcagccgctacagtcgtctctacagcagcggcagcgatgcagggactggagagcgggaa
gcgagctcgagcagactgggttccggcaagttcacgctgagcaacagcagcagcagcggc
gacgtccccaccgccactttcacacttcgcagcagccggacccgtcgcaatgcggaggac
acgacggtggctccggcggcagcagcgcctccaccgccaccgccgccgcctcctccgccc
gccagcacctccaacggccacaggtcggcggagagcaacggcctggaggcgaagctgaac
gggctgtccttgctctcgagttcgccgaaacggaacgccatctacgagagccgcagcggc
agcagcctcaggaacctggacaccaccgacgactcgggtgtgggggcggccggcgcctcc
aaggcggaggacagcaacggggacgtgaccgccacggcgaccttcaagttgggcgacggc
agcagcaagcagcagcagcagcagcagcagttgcaatcgcagccacagcagtcgcataag
cttcacaagctgaagcccatccacggcagctgcaacaacaattcgggcactcccgtatcc
gtatcgattatgaatggtcactcgacggccacaaccaacaacaacaacaacagcggtgga
ctcaacagcagcaacaacgcgatcaacaacaacatgcaacggcagcagcaccaccaccac
caccagcagcagcagcagcacgacgacatcagctacatagacagcgatgagccggcatcg
ggatcggcaggagccgtagccggaactggattagcgagttcgggaggagcaggagcgggc
actggcggtatcaagtccagcatttgctacttcaagccgatcacgccgccgcagctgaga
caccaccaccagcagcgggagcagcgacggggagacgaccaggagacccaggctggcaac
ggcaagcgctacgcccggcccaagtcgaccatcatcgcctcggcccactccaacttcgcg
gccaactacgagaagttcaacaactaccgccagaccaatggcacctctgaccacgccgcc
ggctcggaaccgcgtcacagtgccgggggcgggggcgggggcgtgggcaaccccagcagc
aacgcccggcgctacgggatcgactcgctgagcatcaaggcgtcgattgagaagttcaac
aacctgagcggccagaagcaacggcaagcgactccggcgccagtgcagggagccggatca
cgggcaggctcgtcgggcagctcggcggcgtccgggcgcagcagccagaacattgggagc
agcagcgggaatctgcagcagcgcttcagcagcgatctggacaacgtgcgcgtggcggcc
ggctacagcagctccttgacccgcaccccgtaccggacgacgaccagcgtcggtcaggcg
gcgccgccgacagccgccggctccggcatcgggtcgacggcggtggtgacgcccatgagc
aaggtgacgatgcggggagcccatgcccatagtagcaacaggcaggcggccgactgcgag
gccatgactaaggtaacgaacaacgacaatgccgcgacagccacaccagctgcagcagtg
gcagccacaccaccaccaccaccaccacaccagccatcagccacgtcttccgtctccacc
acagccacagccacagcctccagtacagtccccgacacaagtacagccccagcttcaggc
ccggtatccgccgccgccaccgccgccgccgctggcgatagtacgcaggcgaggagcgtc
accgggagcagcggcagtgctcggagcgtcctgccgcccgtgtcgccgacgtcgagccgc
tactgggaccacgaccgcgatggaaccaccagccgcagcaccgtcggcagcacctcatcc
gccctcacctcgtcctcgctgaagcacagcaccgacgacggctacaagagcgccgcctcg
gcgacccgggaggagaagtcggaaggtttgtgcggtctgagaaatattgggaacacgtgc
ttcatgaactcggtcatccagtgtttgagccacacccaagagttgacccgcttccttcgc
tcgcaccatggatcgcgttcctcctccaccaaggatcagcagatactccacgaatttgcc
aaactcatccaggagatgtggacctcgaatgtgcacactgtgacgccgatggagctgaag
cgcgccttctccactaagcaccgaatgtatagcgactacaaccagcaggatgcccaggag
ttcctgcgcttcttcctcgactcgctgcactcggccctcaactcgggcgtgaagggagag
acgctcaacattgacgataatctcagtgacaataagaaggccgacctcacctgggagtgg
tacacgcggcatgagaactcgctggtgcgcgacctctttgtcggacagctgaagagcacc
ctcaagtgcaccacctgcggcaacactagcgttaccttcgacccgttctgggacctgagc
gtgccattgccctcgtcatcgcgctgcaagctggaggcctgcctggacctcttcattcgc
gaggaggtgctcgacggcgacgagatgcccacatgcgccaaatgcaagacacgccggaaa
tgcaccaagagtttcaccatccaacgtttcccaaaatacctagttatacacttgaaacgt
ttctcggagacgcgctggagcaagctctcaaacatcgtggagttccccaccatggatcgc
gaactcaacatgggctcttatggcgccaactccaactccaatgtgcattactcgctctac
gcgatatccaatcatatgggctcaactgctggtgggcactatgtggccctgtgtaagcat
cccgtttcccgtaagtggcacgagttcaatgataacattgtcagcgatgccttgtccgaa
aactttctcgtttcatccagtgcctatatacttttctatgagcgtgcgtaa

DBGET integrated database retrieval system