KEGG   Drosophila ananassae: Dana_GF21042Help
Entry
Dana_GF21042      CDS       T01059                                 

Definition
GF21042 gene product from transcript GF21042-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dan  Drosophila ananassae
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dan03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MAEVLNLDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVGKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgctcaacctggacagcatcatctcccggctgctggaggtgcgtggggct
cggcccggaaagaacgtccagctgtcggaaggcgagatccggggcctgtgcctcaagtcg
cgcgagatcctgctggcccagcccatcctgctcgagctagaggccccgctcaagatctgc
ggcgacatccacggccagtactacgacctgctccgactgttcgagtacggcggctatccg
cccgagtcgaactatctcttcctgggcgactacgtcgaccggggcaagcagtccctggag
acgatttgcctgctgctggcctacaagatcaagtactcggagaacttctttctgctgcgg
ggcaaccacgagtgcgccagcataaaccggatatatggcttctacgacgagtgcaagcgc
cggtacacgatcaagctgtggaagaccttcacggactgcttcaactgcctccccgtggtg
gcgatcgtggatgagaagatcttctgctgccacggcgggctcagcccggacctgacctcc
atggaacagattcgccggataatgcgtcccaccgacgtgcccgaccagggcctgctgtgc
gacctgctctggtccgatccggacaaggacacgatcggctggggcgagaatgaccggggc
gtgagcttcaccttcggggcggaggtagtgggcaagttcctgcaaaagcacgacctcgac
ctcatctgccgggcccaccaggtggtcgaggacgggtacgagttctttgccaagcgccag
ctcgtcaccctcttctcggcgccgaactactgcggcgagttcgacaacgccggcgcgatg
atgtccgtcgacgacactctcatgtgctccttccagatcctcaagcccgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system