KEGG   Drosophila ananassae: Dana_GF21042Help
Entry
Dana_GF21042      CDS       T01059                                 

Definition
GF21042 gene product from transcript GF21042-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dan  Drosophila ananassae
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dana_GF21042
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dana_GF21042
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dana_GF21042
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dana_GF21042
Spliceosome [BR:dan03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dana_GF21042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MAEVLNLDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVGKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgctcaacctggacagcatcatctcccggctgctggaggtgcgtggggct
cggcccggaaagaacgtccagctgtcggaaggcgagatccggggcctgtgcctcaagtcg
cgcgagatcctgctggcccagcccatcctgctcgagctagaggccccgctcaagatctgc
ggcgacatccacggccagtactacgacctgctccgactgttcgagtacggcggctatccg
cccgagtcgaactatctcttcctgggcgactacgtcgaccggggcaagcagtccctggag
acgatttgcctgctgctggcctacaagatcaagtactcggagaacttctttctgctgcgg
ggcaaccacgagtgcgccagcataaaccggatatatggcttctacgacgagtgcaagcgc
cggtacacgatcaagctgtggaagaccttcacggactgcttcaactgcctccccgtggtg
gcgatcgtggatgagaagatcttctgctgccacggcgggctcagcccggacctgacctcc
atggaacagattcgccggataatgcgtcccaccgacgtgcccgaccagggcctgctgtgc
gacctgctctggtccgatccggacaaggacacgatcggctggggcgagaatgaccggggc
gtgagcttcaccttcggggcggaggtagtgggcaagttcctgcaaaagcacgacctcgac
ctcatctgccgggcccaccaggtggtcgaggacgggtacgagttctttgccaagcgccag
ctcgtcaccctcttctcggcgccgaactactgcggcgagttcgacaacgccggcgcgatg
atgtccgtcgacgacactctcatgtgctccttccagatcctcaagcccgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system