KEGG   Drosophila ananassae: Dana_GF21060Help
Entry
Dana_GF21060      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11851  ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Pathway
dan04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    Dana_GF21060
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF21060
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF21060
Membrane trafficking [BR:dan04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dana_GF21060
Ubiquitin system [BR:dan04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dana_GF21060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 6503749
NCBI-ProteinID: XP_001963810
FlyBase: FBgn0098065
UniProt: B3MR54
Position
Unknown
AA seq 570 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGRTCFLNTLLQALAAC
PQFIAWLQLYNGASPDRRSLISSMLNTLEVVNGTHATLRGDPHSPGAVLRALNTLGWVIP
QEEHDAHELFHVLLSSLEEEATRPQPIGCLSDALPLAGGGENDDTSSIGLGAGTATPVGG
FRPISSMAGPSQRIGDQPNRPSSAMLTDFLNMEYDESTSLTRLVRSEAHTPDSPASVCER
EGNDRLGTMLLDAVSPGTPFGFPLSSAAAADSMPIDVLNSSGGGPGGERMSRTRLPQSQE
LGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRY
DKFDSVTLNLPPQRRTGLSLGHLLSDYITSEDLSDVKCDSCNETTTHTKSVTFAKLPACL
CIHVARTVWLPTGQVCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLP
MNNGVSVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWFYTSDTI
VREVSIDEVLSVPAYLLFYDRGPQRQLPLR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgagaagattctaatggctgccggggtgacggtggccgccgttgtaggagcc
tttgtcttctgggggccctcaggctcccgcctgcgccagcgtcgcggccagatagccgga
cttcacaacttcggccgcacctgcttcctgaacactctgctgcaggctctggcagcctgt
ccgcagttcatcgcttggctgcaattgtacaacggcgcctcgccggaccgccggagtctg
atcagctccatgctgaacaccctggaggtggtcaacggcacgcatgccactctgcgcgga
gacccgcactcgcccggcgccgttctccgtgctctgaacacccttggatgggtgataccc
caggaggagcacgacgcccatgagctgttccacgttctgctctcctccttggaggaggag
gccactcggccgcagcccataggttgtttatcggatgctttgcccctggccggtggggga
gaaaacgatgacaccagcagcattggattgggagcgggtacggccacgcctgtgggtggt
ttccgacccattagctccatggcaggtcccagtcaacggattggagatcagccgaacaga
ccgtcgagtgccatgctcaccgacttcctcaacatggaatacgacgagagcaccagcctg
acgcgcctggtgcgctccgaggcacacaccccggactcgccggcctcggtctgcgagcgg
gaaggcaacgatcgcttgggcactatgctccttgatgccgtgtcgcctgggactcccttt
ggctttccgctttcgtcggcggctgcagccgactcgatgcccatcgatgtgctgaactcg
tctggcggcgggccagggggagagagaatgtcgcggacgcgtctgccgcaatcccaggag
ctcggactgaatcgacgagtgtccagctcctgtcggtcgctggagcgactgcatcgcgga
cctgggcgcgtctctatctggtccaacatgatgcccagccaggtggcgcatcccttccag
ggcgccatgggggcgcagatcgtctgcaacgggtgtggctccaagtcggcagtgcgctac
gacaagttcgacagtgtcactctgaacctgcctccgcagcgccgcacgggattgagcctg
ggccacttgctcagcgactacataacgtccgaggacctgagtgacgtcaagtgcgactcc
tgcaacgagaccaccacccacaccaagtcggtcaccttcgccaagctgccggcgtgcctc
tgcatacatgtggcgcgcacagtctggctgcccacaggccaggtgtgcaagcggcaggac
tacgtccacttccccgagagcctctcgatggcgccctacagcttcgtgcagccgcatctc
aacagccaggctgggaccccgtggggctctaccatgtccctgtactcatccagtctgccg
atgaacaatggcgtaagcgtgggcgggggcgaaggcttcggcaccatgttccccaagaat
ctgtaccgtctcctcgcggtggtggtgcactccggcgaggcaaacagcgggcactttgtg
acctaccggcgcggctcgctaaggaacgcgcatcgctggttctacacatcggacacgatt
gtgcgagaggtgagcatcgacgaggtgctcagcgtgcccgcctacctgctcttctatgat
cggggcccgcagcggcaactgcccctccgctag

DBGET integrated database retrieval system