KEGG   Drosophila ananassae: Dana_GF21061Help
Entry
Dana_GF21061      CDS       T01059                                 

Definition
(RefSeq) GF21061 gene product from transcript GF21061-RB (EC:2.3.1.-)
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF21061
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dana_GF21061
   HAT complexes
    NSL complex
     Dana_GF21061
    MSL complex
     Dana_GF21061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 850 aa AA seqDB search
MMSDAEQEQSGVGDIEEEEQDLGQGQEQEQEQELEQHHGEEEMGEPGGEQAGEEEVYTIQ
AGPPRTPVDDAAAELNSSLDISSSDQSAEYQTLDLTCAKAVREEGLPAAEAEAEVEPEAV
AEAEADAELEGPPPKRERMHTSPISEDYSNPSRSSTSSSSGDSCSRYDEVSEGEVEVVPE
QMQMQEEIMPEMEPAEIETVETDEPADPELDEDMETEDVPSPNTVVCMSDIDDLSHAPTK
AIITEVVTIPAPLCLKLPLGPPAPPPPRGGMNDIPDTPASPTGAGAGTSMAIPSYLGGRY
VYDRITELQQSSMFAMPPRLAPRDPRQRIMPPPMPIGTVLSANIETISDDSNQGEESSSE
EEEEEDDDCIAVENDSTSGEATAATADPMLQKIDISEKSEKIYYIRRDDGTVHAGQVLQV
RSSDNSASPDEYYVHYVGLNKRLDGWVGRHRISDNAEDLGGVTMTPQQAAINDQPGTSSQ
MLAQQAAAAAAATAAAAQRPKRAGNKDYYLSKCETNRYDYSDRKMTRYQKRRYDEINHVQ
KSHTELTALEAALEKEHESITKVRNIDKLQFGNYEIDPWYYSPFPGQYGTAKTLYVCEYC
LKYMSLRKSYAYHQYQCEKRRPPGREIYRKGNISIFEVNGKEEPLYCQLLCLMAKLFLDH
KVLYFDMDPFFFYILCETDREGSHIVGYFSKEKKSLDNNNVACILVLPPHQRKGFGKLLI
AFSYVLSRKEGVIGSPEMPLSDLGRLSYRSYWAYTLLELMKNRCSPEQTTIKELSEMSGI
THDDIIYTLQSMAMIKYWKGQNVICVTAKTIHDHLQLPQFKQPKLTIDLDYLAWKPHNTA
STSRLSGVSG
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgacgcggagcaggaacagagtggcgttggggatatagaggaggaagagcag
gacctgggccaaggccaagagcaagagcaggagcaggaactggagcagcaccacggcgaa
gaggagatgggcgaacccggaggtgagcaggcgggagaagaagaagtctacactattcag
gcgggaccgccccggacgccggtagacgacgcggcggcggagctgaactccagtctggac
atcagcagctcggatcagtcggcggagtatcaaaccctggatctaacttgtgccaaggct
gtgcgtgaggaagggcttcccgcggctgaagcggaagcggaggtggagccggaggcagtg
gcggaggcggaggccgacgcggaattggaagggccccctcccaaacgcgaaaggatgcac
accagccccatttccgaggactacagcaaccccagccgcagttccacctcctcgagcagc
ggggacagctgctcccgctacgacgaagtcagcgagggggaagtggaggtggtgccggag
cagatgcaaatgcaggaagaaattatgccagagatggagccagcggagatagagactgtg
gagacggacgagccagcagatccggagctggacgaggacatggagacggaggacgtgccc
tcgccgaatacggtggtgtgcatgagcgacatcgacgatttgtcccacgctcccaccaaa
gccatcataacggaggtggttaccattcccgcgccactgtgtctaaagctgccactgggt
cctccggccccgccaccacctcgagggggcatgaatgatatcccagacacgccggcctcg
cccacgggagcgggcgcaggtacatccatggccattccgtcgtatctaggtggccgctac
gtctacgataggatcacggagctgcagcagtcgtcgatgtttgctatgccacctcgtctg
gcgccgcgggatccccgccagcgcattatgccgcctccgatgcccattggaacggtgctc
agcgccaacattgagaccatctcggacgacagcaaccagggtgaggagagcagcagcgag
gaggaggaggaggaggacgacgactgcatcgccgtagagaacgacagcacctcgggggag
gcgacggccgccacagccgatccgatgctccagaagatcgacattagcgagaagtccgag
aaaatctactacatacgacgcgacgatggcaccgtccacgccgggcaggtgctgcaggtt
cgcagctcggacaactctgcctcgccggacgagtactatgtgcactacgtgggactcaac
aagaggttggacggctgggtgggtcgccaccgcatttccgacaacgccgaggacctgggc
ggggtcacgatgacgccccagcaggctgcgataaacgaccagcctggcacgagcagccag
atgctggcccaacaggcagcagcggcggcggcggctacggcggctgcggcgcagcgaccg
aagagggcgggcaacaaggactactatctgtcgaagtgcgagaccaatcgctatgactac
agcgaccggaagatgacccgctaccagaagcggcgctacgacgagatcaaccacgtccag
aaaagccacaccgagctgacggcgttggaggcggcgctggagaaggagcacgaatcgatc
accaaagttaggaacattgacaagctccagttcggcaactacgagatagacccctggtac
tacagcccgttcccggggcagtacggcaccgccaagacgctctacgtctgcgagtactgc
ctgaagtacatgtcgctgcggaagagctatgcctaccaccagtaccagtgcgagaagcgg
cggccgccgggcagggagatctaccgcaagggcaacatctccatcttcgaggtgaacgga
aaggaggagccgctctactgccagctgctctgcctgatggccaagctcttcctcgaccac
aaggtcctctacttcgacatggacccgttcttcttctacatactgtgcgagacggatcgc
gagggcagccacatcgtgggctacttctccaaggagaagaagtcgctggacaacaacaac
gtggcctgcatcctggtcctgccgccccaccagcgcaagggcttcggcaagctgcttatc
gccttcagctacgtgctgtcccgcaaggagggcgtgatcgggagtccggagatgccgctg
tcggacctgggcaggctcagctatcgcagctactgggcgtacacgctgctcgagctgatg
aagaaccggtgctcgccggagcagaccaccatcaaggagctgagcgagatgagcggcatc
acccacgacgacatcatctacacgctgcagtcgatggctatgatcaagtactggaagggc
cagaacgtgatctgcgtcaccgccaagaccatccacgaccacctccagttgccgcagttc
aagcagccgaagctcaccatcgacctggactatctcgcgtggaagccgcacaacacggcg
tccacttcccggctgtccggagtctccggctga

DBGET integrated database retrieval system