KEGG   Drosophila ananassae: Dana_GF21081Help
Entry
Dana_GF21081      CDS       T01059                                 

Definition
GF21081 gene product from transcript GF21081-RA
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1169 aa AA seqDB search
MSGTTGRRVALRETLTSLRYSAEFTSQEAKAKHLFAMVKKRQTDAHDATSSTDSGEDDRH
QLHHHHPGGRSAGPAGASIDGSSPSSSTMCQHIKRAVDATKLRRQLKTTGLVYECSQCQK
LGQQKQSPDADAGPKSGDIEYDSTLWLCLKCGTQLCGRSRNKHALEHHKTPRSESHALAM
NTRSFDIYCYECEMKICSNLRKNLLECVELVKRLAQKPPATPQPPTISNLEMKIKSTVEQ
ITSMAPLAMAPGAAVGTFDESSAGAAGGGTRSSQVAIPMPPPPPNAAQASAAGAGTLTSV
PGIAKRIVQQNGGVTGAAAGVRAVPGDTPRNDLDRLPRVRGLTNLGNTCFFNAVMQCLAQ
TPFLLSVMRELAEPGEEFVLPGGTFNFKDKGDVELPMIKGTLSSWGGLTAALANALEELQ
AGGSVFTPSKLFDKLCAKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYK
DQEISSVSEEMRQKCKIYGNQAGERILRPDQVFRGFLVSTLTCQDCHSVSSRHEYFLDMS
LPVAVEKPQPPQRRKPSPEHPLISQPAAQPAINTKFTAGESSVSFTASSSSSFYLHSDQT
EATSLGPSKIQVKKEKERERKAKRAAKHQRHKQAQKLSLKLNGSDLEASVPDAPQLVALG
AGDGQTRIEGGEQPKEQTEDTTSSSVTTSEHSDADVEDNLVEDSAPVSASANTASSSTST
STSSGGAVGGKFYTDSNGNAQPLGEKRDDTPEHMDKDSLEEDENDSGIATSPAPTATSSS
STVVAGDSTTNNSGTSSGTLEDASAPASLVSAGLSEKGASLIRQFSNGGTAIESDTQVSA
ELEKLSLEEPGKPPIHDQKQKATEPLLTQAQAQAQASARAKRVRTQSYSDWSTTIAPRYQ
CEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTLRINGNDPKAKSVNTNATKQLLVSSPP
AVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYG
VVEHSGGMYGGHYTAYVKVRPKVTPDDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKA
RELHLNAMDDSDDFTNSSSNSSTSDEGNAPVTPSEEQQPPQTTPPGEEAAHVQAPPGKWY
YVSDSRVQEVSEDSALKAQAYLLFYERIY
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaccacggggagacgtgtggcactgcgagaaactcttacttctcttagatac
tcggcagagttcaccagtcaggaggccaaggccaagcatctgttcgctatggtcaagaaa
cgccagacagatgcccacgacgctaccagctcgacggactccggggaggatgaccgccac
cagttgcaccaccaccatcccggtggcaggagtgccggaccagccggcgcctccatcgac
ggctcctcgcccagttcctcaaccatgtgccagcacataaagagggcagtggacgccacg
aaactgcgtcgccagctgaagaccacgggcctggtgtacgagtgctcccagtgccagaag
ctgggccagcagaagcaatctccggacgcggacgcaggcccgaagtccggcgacattgag
tatgacagcacgctctggctgtgcctcaagtgtggcacccagctctgcggcagatcccgc
aacaagcatgccctggagcaccacaagacaccccgctccgagtcccatgcgctggctatg
aacacgcgctccttcgacatctactgctatgaatgcgaaatgaagatctgctccaatctg
cgcaagaacctgctcgagtgcgtggagctggtgaagcgattggctcagaagccgcccgcc
acgccccagccacccaccatcagcaacctcgagatgaagatcaagtcgacggtggagcag
atcacctccatggctccgctggcgatggcgcctggagcggccgtgggcaccttcgacgag
agcagtgctggggcagcgggtggcgggacccggagtagccaggtggctataccgatgcca
ccaccgcccccgaatgcagcgcaggcctccgccgcgggagccggcaccttgaccagtgtg
ccgggaatagcgaagaggatcgtccagcagaacggaggagtaaccggagcagccgcagga
gtgcgagcggtgcccggggacactccgcgaaacgacttggacagattgcccagagtacgc
gggctgaccaatctgggcaacacgtgcttcttcaacgcggtgatgcagtgcctcgcccag
acacccttcctgctcagcgtgatgagggagctggcggagccgggggaggagttcgtactg
cccggcggcaccttcaacttcaaggacaagggagacgtcgagctgccgatgatcaagggc
actctctcctcctggggcggcctgaccgccgcgctggcgaacgccttagaggagctccag
gccggcggcagcgtcttcacgcccagcaagctcttcgacaagctctgcgcgaagtgtcct
cagttcacgggcggcgaccagcacgacgcccacgagctgctgcgccagttgctggagagc
gtgcgcaacgaggacctgaagcgctaccagcgggtgattctgcagaacctcggctacaag
gaccaggagatcagcagcgtgtcggaggagatgcgtcagaagtgcaagatctacggcaac
caggccggcgaacgtattctgcgcccggaccaggtgttccgcggcttcctcgtctccacg
ctcacctgccaggactgccatagcgtgtcctcgcggcatgagtacttcctggacatgtcg
ctgccagtggcagtggagaagccacagccaccgcagcgccgcaagcccagtccggagcac
ccgctgatcagccaacccgccgcccagccggcgatcaacaccaagttcactgccggagag
agcagtgtcagcttcacggcttcctcatcgtcatcattctacctccactccgaccagact
gaggccaccagcctcgggccctcgaagattcaagtgaagaaggagaaggagcgggagcgc
aaggcgaagcgggccgccaagcaccagcgccacaagcaggcccagaaactgagcctcaag
ctcaacgggagcgacctggaggcgtccgtgccagacgctccccagctagtcgctctaggt
gccggcgatggccagacgaggatcgagggcggtgagcagcccaaggaacagaccgaggac
accacgtcgtccagtgtcaccacctcagagcactcggacgccgacgtggaggacaacctg
gtagaagactctgccccagtctccgcctcagccaacacagcctccagttccacctcgacg
tccacgtcctcgggcggcgcggttggcggcaagttttacacggacagcaatggaaacgcg
cagccacttggcgagaagcgggacgacactcccgagcacatggacaaggactcgctggag
gaggacgagaatgactctggaattgccaccagcccggctcccacggcaaccagcagcagc
agcaccgtcgtggctggagactccacgacaaacaactcgggaacctcctccggcaccctg
gaggacgcctctgcgccggcgagtctggtcagcgccggcctctccgagaagggagcctcc
ctgatacgccagttctcgaatggaggcacagctatcgagtccgatactcaggtgagtgcc
gagctggaaaaactaagtctggaggaacccggcaagcctccgattcatgatcagaagcag
aaggccactgagccgctcctcacccaggcccaagcccaggcccaggccagcgccagggcg
aaacgagtgcgcacccagagctactcagactggagcaccaccattgccccgcgctaccaa
tgcgaggacggagagtgctccgtgcagtcgtgcctgaacaacttcaccgccgtggagttg
atgaccggccagaacaaggtgggctgcgacagctgcaccctgcgcatcaacggaaacgat
ccaaaagccaagtcggtgaacacgaatgccaccaagcagctgctggtctccagtccgccg
gcggtgctcatcctgcacctgaagcgcttccaactgggcccgcgctgcatcttccgcaag
ctaacgcgtccagttagctacccgaacttgctggacatcgctgcgttttgtgggtcgaag
gtgaagaatctgccgaacatcgaccgcaagcaaaagaagctgctgtacgctttgtacggc
gtggtggagcactcgggtggcatgtacggaggccactacacggcctacgtgaaggtgcgg
cccaaggtgacgccggacgacaagcgctggaagttcctgccccacggcagcaaggcggaa
ctggaccaggacgacgatcagctgaaaaagctggaggagctcctggccaaggagaaggcg
cgtgagctgcacctgaatgccatggacgacagcgatgacttcaccaactccagcagtaac
tcctcgacgtcggacgagggcaatgctccggtaacacctagcgaggagcagcagccacca
cagacaacgccgcctggggaggaagcagcccacgtgcaggcgccgcccggaaagtggtac
tatgtctccgattcacgtgtccaggaggtgagcgaggactcggcgctgaaggcacaggca
tacctgctcttctacgagcgcatatactaa

DBGET integrated database retrieval system