KEGG   Drosophila ananassae: Dana_GF21160Help
Entry
Dana_GF21160      CDS       T01059                                 

Definition
GF21160 gene product from transcript GF21160-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dana_GF21160
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   Dana_GF21160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 401 aa AA seqDB search
METPRRKLRDLHLENVQNSSTPICIPPSPLLKTLGHGTGVSVYRLDRSPRQGQVRSPWAV
KRITQNPRIKKDPVFNERIMHEAQILRKLKHPNIVGFRGLVTGPGGVSTLVLEVCNTSLG
SILEERHDEDLGPLPPKNTLKMIMDVAMALDFLHNEARLLHGDLKSFNVLIKGEFEICKL
CDFGVSMPLDENGEVNMVKNAAQCYVGTCLWSAPEVIDQVEIIDSKADIFSFGLVIYETL
ALVPPHTLELDEALGEDLENSHDLDANKKYNKQQVQKLDFTDCTESSVNFEEDKSELEGM
EVSQQVDAEEPSLAESEGKETSEEEDDTKENDISEFSLNNLQSAYGTRPPLPVAFQLSAD
YNCIVELFYLCTNALSEDRPAARTIWQSLENNALNVGCGGD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggagactccgcgccgcaagctgcgcgacctgcatttggaaaacgtgcagaacagcagc
accccaatctgcattccgccatcgccgctgctgaagacccttggccacggcaccggggtc
agtgtttaccgcctggaccgctccccgcgccagggtcaagtgcgctccccgtgggccgtc
aagcgcatcacccagaaccccaggatcaagaaggacccggtcttcaacgagcgaatcatg
cacgaggcccagattttgcggaaactgaagcatcccaatatcgtaggcttccgcggattg
gtcaccggtcccggaggagtcagcactctggtcctggaggtgtgcaacacctcgctggga
tccattctggaggaacgccatgacgaggatctgggccccttgccgcccaagaatacctta
aaaatgatcatggatgtggccatggccttggactttctgcacaacgaggcccgcctgctg
catggcgatctcaagtccttcaatgtcctgatcaagggcgagtttgagatttgcaaacta
tgcgactttggggtgtccatgccgctggacgagaacggtgaggttaacatggttaaaaac
gcagcgcaatgttacgtgggaacctgcctctggtcggctccggaggtaatcgatcaggtc
gagatcatcgacagcaaggctgacattttcagctttggcctggttatctacgagaccttg
gcgctggtcccaccgcacacgttggaactggacgaagcgctgggcgaggacttggagaac
tcgcacgacttggacgccaataagaaatacaataagcagcaggtccaaaagcttgatttc
actgactgtaccgagtcctcggtcaacttcgaggaagacaaatcagagcttgaaggcatg
gaagttagtcaacaggtcgacgcggaggagccatcccttgcggagtccgaaggcaaggag
acctctgaggaagaagatgatacaaaagagaatgacatctccgagttttcgctgaacaat
ctgcagtcggcctacggcacgcgcccaccactgccggttgcattccagctgagcgccgac
tacaactgcatcgtggagctgttctacctgtgcactaatgccctcagcgaggatcgcccg
gctgccaggaccatttggcagagcctggaaaacaatgcactcaacgtcggatgtggcggg
gactag

DBGET integrated database retrieval system