KEGG   Drosophila ananassae: Dana_GF21197Help
Entry
Dana_GF21197      CDS       T01059                                 

Definition
GF21197 gene product from transcript GF21197-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dan  Drosophila ananassae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dan00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 762 aa AA seqDB search
MAASVVKASKCSRRGSTKELAKNPAKNASDSSNKANWNWGLLLATVFLITFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGKFAFEKPGDKYNE
TRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAAILSAAYLVFDVGLLTLNQYILLDPI
LLFFMMASIWGMVKISKATADGASYGLRWWAWLFFTGTMLACTISVKFVGLFVVLLVGLH
TATELWLILGDLEKPIWETAKQVACRAVTLIIWPVFLYTVFFYIHLSVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSVVTIKNHKTGGGYLHSHFHLYPKGVGARQQQITTY
THKDENNKFVIKPHNKQKVPKDKLQLLKHGDLIRLEHLMTKRNLHSHAEPSAMTKKHHQV
TGYGENGIGDVNDVWRVMVVGGKINETVHTVTSRLRFIHMVQNCALTSSGKQLPKWGFEQ
QEVSCNPNIRDKNSQWNIEDNEHKLLPSVSFSIYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRPWQWPINYKGQYFSGSQYRIYLLGNPVIWWSNLIFLGLFVVVFMYNAVVQQRRD
GLAEAQALVLAQESRRSPCPAQSEDSEPSTTDVCSCCPTPPSPQKPEPEAPRQPSRSLQA
AAWLFVGWVLHYLPFWAMGRVLYFHHYFPALIFNSMLTGIIFNYIIRPLPKWIQHVLLGG
VLSVLVYSFAVFSPLAYGMTGPMANEPNSTMHKLKWLPTWEF
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaagtgtggtgaaggcttccaagtgctccaggcgaggttccactaaggaactg
gccaagaatccagcgaagaatgcatccgattccagcaacaaggccaactggaactggggt
ctccttctggccaccgtcttcctgatcacctttgccacccgattctacaaggtcaccgaa
ccggatcacatttgctgggacgagactcactttgggaagatggggagttggtacatcaac
cgcaccttcttcttcgatgtccacccaccgctgggaaagatgctgattggtctctcgggc
tacttgacgggctacaatggaaagttcgccttcgagaaaccaggcgacaaatacaacgaa
acccgttaccagggcatgcgatacttctgcaccaccctgggggctctcatcatgcccatg
ggcttcgacacggtctacgatctgaccagatcccacgaagcggccattttgtcggctgcc
tatttggtctttgacgtcggcctgcttaccctcaaccagtacatcctgctcgaccccatc
ctgctcttcttcatgatggcctccatctggggcatggtgaagatctcgaaggccaccgct
gacggcgcctcctacggcctgcgctggtgggcgtggctcttcttcaccggcaccatgctg
gcctgcacgatcagcgtgaagttcgtgggcctgttcgtggtcctgctggtgggcctgcac
accgccacggagttgtggctcatcctgggcgacctggagaagcccatctgggagaccgcc
aagcaggtggcctgccgggccgtcaccctcatcatctggcccgtcttcctctacaccgtc
ttcttctacatccacctgagtgtcctgaaccggagcggcaacggggacggcttctacagc
tccgccttccagtcgcgcctcatcgggaactcgctctacaacgccagtatgccccgggac
gtggcctacggctcggtggtcaccatcaagaaccacaagaccggagggggctacctccac
tcccatttccacctgtatcccaaaggagtgggcgcccgacagcagcagataaccacttac
acgcacaaggacgagaacaacaagttcgtgatcaagccccacaacaagcagaaggtaccc
aaggacaagctgcagctcctcaagcacggagacctcatccggctggagcatctcatgacg
aagcgaaacctccactcccacgccgagccctcggccatgacgaagaagcaccaccaggtc
acaggatacggagagaatggcatcggcgatgttaacgacgtctggcgggtgatggttgtg
ggtggaaagatcaacgagacggtccacacggtgacctcccggctgcggttcatccacatg
gtgcagaactgtgccctcacctccagcggcaagcagctgcccaagtggggcttcgagcag
caggaggtgtcctgcaacccgaacatccgcgacaaaaactcccagtggaatatcgaggac
aacgagcacaagctgctgcccagtgtcagcttcagcatctacgctcctgggttctttgcc
cgcttcctcgagtcccacgccgtgatgcttcagggcaacgcaggactcaagcccaaggag
ggcgaggtcaccagtcgtccctggcagtggccgataaactacaagggccagtacttttcc
ggaagccagtaccgcatctacttgctgggcaaccctgtgatctggtggagcaacctcatc
ttcctgggcctcttcgtcgtggtctttatgtacaacgccgtcgtccagcagcgcagggac
ggcctggccgaggcccaggcgctggtcctggcccaggagagccgccgctctccgtgtccg
gcccagagcgaggacagcgagccctccaccacggacgtctgcagctgctgcccgactccc
cccagcccccagaagcccgagccggaggctcctcgccagccatcgagatccttgcaggcc
gccgcctggctcttcgtgggctgggtgctccactacctgccgttctgggccatgggccgg
gtgctctacttccaccactacttcccggccctgatcttcaactccatgctgacaggcatc
atcttcaactacatcatccggcccctgcccaagtggatccagcacgtcctgctcggcgga
gtcctctccgttctggtctacagcttcgccgtcttctcgccactggcctatgggatgacc
ggcccgatggccaacgagccgaactccacgatgcacaagctcaagtggctgcccacctgg
gagttctag

DBGET integrated database retrieval system