KEGG   Drosophila ananassae: Dana_GF21222Help
Entry
Dana_GF21222      CDS       T01059                                 

Definition
(RefSeq) GF21222 gene product from transcript GF21222-RB
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF21222
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dana_GF21222
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dana_GF21222
   HAT complexes
    Elongator complex
     Dana_GF21222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 549 aa AA seqDB search
MKPKKKLGVGLSREERQVLVVGEIIQELLRAHEAKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQEAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVAHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALLPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGACSIVRELHVY
GSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKLGYELD
GPYMSKSIG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaagaagaagttgggagtcggtctaagccgggaggaacgacaagttctggtc
gtcggtgagatcattcaggaactactgcgggcgcatgaggccaaaaaggatgtgaaccta
aaccgaatgaagtcattgatatcctccaaatatggactggacagctcgccgcgcctggtg
gacatcattgcagctgtgccacaggaagccaagaagatccttttgcctaagctaagggcc
aagcccattcgcacagccagtgggatcgctgtggtggcggttatgtgcaagccgcatcgc
tgcccacacataaacatgacaggaaacatatgcgtgtattgtcccggcggtccagacagc
gactttgagtattcgacgcagtcgtacactggctatgagcccacttcaatgcgagccatc
cgagcacgttatgatccatttctgcagacacggcacagggtcgaacagctcaaacaactg
ggacacagtgtggacaaggtggagttcatcgtgatgggcggcacgtttatgtgcctgtcg
gaagagtaccgggactacttcatccgtaatttgcacgacgctctctctggccacagcagc
gcaaatgtggccgaggccgtccgttactcagagaaatctcgaacgaagtgcattggaatt
acgatagaaacacgaccagactattgcctcaagcggcacatctccgacatgttgaactat
ggctgcacccggctggagattggagttcagtcggtatacgaggatgtggcaagagacacg
aacaggggccatacagtgcgcgccgtctgcgagagttttcaactgggcaaggatgctggc
tataagatagtggcgcacatgatgcccgatttgcccaacgtggacttcgagcgggacatc
gaacagttcatagagtactttgagaatcctgctttccgttccgatggccttaagatctat
cccacgctcgtcattcgtggcactgggctctacgagctgtggaagaccggacgctacaaa
tcctaccccccgtccatgctggtggatctagtggctaagattctagctcttttgcctcca
tggacgagagtataccgagtgcagcgagacattcccatgccattagtgagttctggtgtg
gagcatggtaatcttcgtgaattggctttggcacgtatgaaggacctcggcaccacctgc
cgcgacgtaagaacgcgggaagtaggcatccaggaaatccacaacaaggtgcgtccctac
gagattgagctaatacgtcgcgattatgttgccaacggtggctgggaaacgttcctttcg
tatgaagaccccgagcaggatattctcgttgggctgctgcggctgcgcaagtgctcaccg
gacactttccgcccagagctgaaaggagcctgttctattgtccgagaacttcatgtgtac
ggctccgtggtgccagtaaatgctcgtgatcccaccaagttccagcaccagggctttggc
atgctgctgatggaagaggcggaacgcatcgcccgtgaagagcacggcagcaccaagttg
gcagtcatatcgggagtgggtactagaaattactaccgaaaactgggctacgagttggac
ggaccatatatgtcaaagtctataggatga

DBGET integrated database retrieval system