KEGG   Drosophila ananassae: Dana_GF21240Help
Entry
Dana_GF21240      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K03957  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
dan  Drosophila ananassae
Pathway
dan00190  Oxidative phosphorylation
dan01100  Metabolic pathways
Module
dan_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Dana_GF21240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_oxidored
Motif
Other DBs
NCBI-GeneID: 6503924
NCBI-ProteinID: XP_001963857
FlyBase: FBgn0098242
UniProt: B3MRA1
Position
Unknown
AA seq 55 aa AA seqDB search
MVLGLDKRYLWSALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPGGSDKEPSW
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggttctgggtctggacaaacgatacttgtggagcgccctgccgctgttgggattcgcc
attggacacttcctggacaagaaggaaacggaacggatgaccatgttccgtgacaaaagt
gctctgtacggtcgaccaggaggcagcgataaggaaccgtcttggtaa

DBGET integrated database retrieval system