KEGG   Drosophila ananassae: Dana_GF21240Help
Entry
Dana_GF21240      CDS       T01059                                 

Definition
GF21240 gene product from transcript GF21240-RA
Orthology
K03957  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
dan  Drosophila ananassae
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dan00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 55 aa AA seqDB search
MVLGLDKRYLWSALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPGGSDKEPSW
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggttctgggtctggacaaacgatacttgtggagcgccctgccgctgttgggattcgcc
attggacacttcctggacaagaaggaaacggaacggatgaccatgttccgtgacaaaagt
gctctgtacggtcgaccaggaggcagcgataaggaaccgtcttggtaa

DBGET integrated database retrieval system