KEGG   Drosophila ananassae: Dana_GF21296Help
Entry
Dana_GF21296      CDS       T01059                                 

Definition
GF21296 gene product from transcript GF21296-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dan  Drosophila ananassae
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dana_GF21296
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dana_GF21296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 652 aa AA seqDB search
MTLQLSSQNGICPVPQQAYYHRQHRHHGQESKPKLRQDQSQVLQGHSMPLLPVMLLLLMA
TLLTRPLCVISNRLSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLG
FSKRGGLADADICFFENQNGFFNAVTDTYTSPDGGWVRRDYQQDCEVFKMDEFTLAFKRK
FDTCDPLDLRLHEGTMYVVWARGESELALEDHQFALPNVTAPHEAGVKMLQLLRADKILI
PENDLDQFEITLKEAPIPAEETTYWCHVQRLDSVVQRRHHIVQFEPLIKTPGIVHHMEVF
HCEAGEHEEIPLYNGDCKELPARAKVCSKVMVLWAMGASTFTYPPEAGLPIGGPGFNPYV
RLEVHFNNPDKQAGLVDNSGFRIKMSKRLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSG
YCVADCTRAALPSTGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDYYSNHFQEMR
TLHYKPRVLPGDALVTTCYYNSLQDKSTALGGFSISDEMCVNYIHYYPATKLEVCKSSVS
EETLENYFIYMKRKEHQHGIHLNGARSANYRSIEWSQPRVDQLYTMYIQEPLSMQCNRSD
GARFEGRNWEGVAPTPVQIRIPIHRKLCPNYNPLWLKPLEKGDCDLLGECIY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcagttgagcagccaaaatggcatttgtcctgtcccacaacaggcttattac
catcgccagcaccgccaccatggccaggagtcgaagccaaagttgagacaggaccaaagc
caagtccttcaaggacactcgatgccgttgctgccagtgatgctgctcctgctgatggca
accctactgactcgcccactttgcgtaatttccaatcgtctgtcggacacgaagctgcac
gagatctacctggacgacaaggagatcaagctgagctggatggtggactggtacaagcag
gaggtgctattccatctgcagaacgctttcaatgagcagcaccgatggttctatctggga
ttctcgaagcgcggcgggctcgccgatgcggatatttgctttttcgagaatcagaatgga
ttcttcaacgccgttactgacacctacaccagtccggacgggggctgggtgcgccgggac
tatcagcaggactgtgaggtcttcaagatggacgagtttacactggccttcaaacggaag
ttcgacacctgcgatcccctggatttgcgactccatgagggaaccatgtacgtggtatgg
gcccggggcgagtccgagctggctctggaggatcaccagttcgccctgcccaatgtcacg
gctccccacgaggccggcgtcaagatgctgcagttgctccgcgccgacaagatactcatt
cccgagaacgatctggaccagtttgagatcaccctgaaggaggcacccatacccgccgag
gagactacctactggtgccatgtccagcgcctggacagcgtcgtccagcggcgccaccac
atcgtccagttcgagccgctgatcaagacgcccggcatcgtccaccacatggaggtgttc
cattgcgaggcaggggagcacgaggagatccccctttacaatggcgactgcaaggagctt
ccggcgcgggccaaggtctgctccaaggtgatggttttgtgggccatgggagccagtacg
tttacctatcccccggaggcgggcttgcccatcggcggtcctggcttcaatccctacgtg
cggctcgaagttcacttcaacaatccggacaagcaagcaggtctcgtggacaactccggc
ttccgcatcaagatgtcgaagagactgcggcagtacgatgccgctgtgatggaactggga
ctggagtacaccgacaagatggccatcccgccggggcagacggccttcccgctgagcggt
tactgtgtggcggactgcacccgggccgccctgccctccaccggcatcataatcttcggc
tcccagctgcacacccacttgcggggcgtgcgcgtcctgacccgccactttcgcggcgag
caggagctgcgcgaggtgaaccgggacgattactactcgaatcacttccaggagatgcgc
accctgcactacaagccgcgcgtcctgccgggagatgctttggtcaccacttgctactac
aactcgctgcaggacaagagcaccgccctcggaggattctccatcagcgacgagatgtgc
gtcaactacatccactactatccggctaccaagctggaggtctgcaagagctccgtatcc
gaggagacgctggagaactatttcatctacatgaagcgcaaggagcaccagcatggcatc
cacctgaacggagccagatccgccaactaccggagcatcgagtggagccagcccagggtg
gaccagctctataccatgtacatccaggagccgctcagcatgcagtgcaataggtcggac
ggcgctcgctttgaggggcgcaactgggagggcgtggccccgacgcccgtccaaatcagg
atccccatccaccggaagctctgtcccaactacaatcccctctggctgaagccgctggag
aagggagactgcgatctgctcggcgagtgcatctactaa

DBGET integrated database retrieval system