KEGG   Drosophila ananassae: Dana_GF21403Help
Entry
Dana_GF21403      CDS       T01059                                 

Definition
GF21403 gene product from transcript GF21403-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 335 aa AA seqDB search
MSKRPRPMPISISKEPEQTIVPPRNLDSRATIQIGEQTFDIEADSLEKICDLGRGAYGIV
EKMRHRQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMDTSLDKFYPKVFLHDLCMEESVLGKIAMSVVSALHYLHAHLRVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGISM
IEMATGRFPYDNWRTPFEQLRQVVEEDPPRLPAGKFSPEFEDFIAVSLQKEYKARPNYEQ
LLRHSFIVDHLQRNTDISEFVSRILDAPDAPVAAQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacgtccgcgacccatgcccatttccatttccaaagagccggaacaaaccatt
gtaccgccgcgtaatctggattcccgggcaaccattcaaattggcgaacaaaccttcgac
attgaggccgacagcctggagaagatctgcgatttgggccgtggcgcctatgggatcgtt
gagaagatgcgacatcgccaaaccgacacagttctggccgtcaagcgcatccccatgacc
gtgaatatacgggaacagcatcgcctcgtcatggacctggacatatcgatgcgttccagc
gactgcccctatacggttcatttctatggtgccatgtacagggagggcgatgtctggatc
tgtatggaggtgatggacaccagcctggacaagttctatccgaaggtcttcctccacgac
ctgtgcatggaggagagtgtgctgggcaagattgccatgagcgtggtgagtgccctgcat
tatctgcatgcccacttgcgggtcatccatcgggatgtgaagccctccaacatattgatt
aatcgcgccggccaggtcaagatctgtgactttggcatctcaggctacctcgtggactcc
attgccaagaccattgatgctggatgcaagccctatatggcaccggaacgcatcgatccc
cagggtaatccggcgcagtacgacatccgctcggacgtttggtccctcggcataagcatg
attgaaatggcaacgggccgcttcccctacgataactggcggacgcccttcgagcaactg
cgtcaggtggttgaggaggatcccccacgcctgccggctggcaaattttcaccagaattc
gaggacttcatcgccgtcagcctgcagaaggagtacaaggcgagacccaactacgagcag
ctgctcaggcacagctttattgtggatcatctgcagcggaacacggacatttccgagttt
gtatcccggatactggacgcgccagatgcgccggtggcagcgcagtag

DBGET integrated database retrieval system