KEGG   Drosophila ananassae: Dana_GF21492Help
Entry
Dana_GF21492      CDS       T01059                                 

Definition
GF21492 gene product from transcript GF21492-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF21492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 553 aa AA seqDB search
MKINNKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPA
SGGAASGPGGAVSASASASAAAAAAAASAAAAAAAASASTGATPVASSGGELVNGNNLAA
ALQKRINRKRKVHGGSAHGHHASQAQQQHAHPQTPQTPTTATPVHVTGDGLISGAANEDG
DGSQDGKIPTPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMSCIY
ICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAK
LFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGY
GKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPNTEGEKPTIT
INDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRDTIEQHRRAMEKRKIRIDSKCL
HWTPKDWSKRSKW
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaacaataaatatgagttcgatgacgatgtggcctccatatgcgagtcgacg
gctgccttaacggagggctgtcggttacccgtaaggatgcacaaaacagatgactggccg
ctggcggagattgtgagcatcaaggagctggacggtcggcgccagttctacgtgcactat
gtggacttcaacaaacgtctggacgagtgggtgaacgaggaggatctgtatacccgcaag
gtgcagttcccacggagagatggctcccagactggcaccagtacgggagtaacgactccg
cagcggcatcattccctggcggggagcgtttcccggcctacttctccccaacatcctgcg
tctggaggtgcggccagtgggcctggaggagcagtgtcagcatcagcatcagcatcggca
gcagctgcagcagcagcggcatcagcagcagccgcagcagcggcggcgtcggcgtcgacg
ggagcaactcctgtggcaagtagtggcggcgagctggtaaacggcaacaacctagcggca
gccctgcagaagcgcatcaaccggaagcggaaggtgcacggcggttcggcgcacggacat
cacgcctcccaggcccagcagcagcatgcccatcctcagacgccccagactcccaccacc
gccacacccgttcacgtcacaggcgatggcctgatcagcggggcggcgaacgaggatggg
gacgggtcgcaggatgggaagattccaacgccccggcaatccggtagcatggtcactcac
caggacgacgtggtcacccgcatgaagaacgtcgagatgatcgagctgggcaggcatcga
ataaagccgtggtacttctcgccctacccgcaagagctctgccagatgtcctgcatctac
atctgtgagttctgcctgaagtaccggaagagtcgcaagtgcctggagcggcatctgtcc
aagtgcaatctgcgccatccgcccggcaacgagatctaccggaagcacaccatttccttc
ttcgagatcgacgggaggaagaacaaggtctacgcccagaatctctgcctcctggccaag
ctgtttctggatcacaagaccctctactatgacaccgatcccttcctgttctatgtcatg
accgagttcgattcccggggctttcacattgtgggctacttctccaaggagaaggagagc
accgaggactacaacgtcgcctgtattctcacgatgccaccgtaccagcgcaagggctac
gggaagctcctcatcgagttcagttacgagctctccaagttcgagggcaagaccgggtcg
ccggagaagccactgtccgatctgggcctgctgtcctatcgctcgtactgggcgcagacg
atactggagatcttcattagccagaatccgaacacggagggcgagaagccaaccataacg
atcaacgacatctgcgagtgcacctccatcaagaaggaggacgtgatctccactttgcag
aacctcaacctgatcaactactacaagggccagtacatagtgtgcatcaatcgggacacc
atcgagcagcatcgtcgggcgatggagaagcgcaagattcgtatcgattccaagtgcctc
cactggacgcccaaggactggtccaaacgctccaaatggtaa

DBGET integrated database retrieval system