KEGG   Drosophila ananassae: Dana_GF21665Help
Entry
Dana_GF21665      CDS       T01059                                 

Definition
GF21665 gene product from transcript GF21665-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dana_GF21665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 511 aa AA seqDB search
MGISAQLFSLLLLTALVAAKTKTSPVQENIAEYKDFKKLLRTKNNVLALYVTSAKAAAAE
LKVFREAAEAIRGTGTMILLDCGQADRKKLCKKLKVSPDPYAIKHYKDGDYHKDYDRQLS
VASMVTFMRDPSGDLPWEEDPAGDDVLHFSDAGSFTKHLRKDIRPMLVMFHVPWCGFCKK
MKPDYGKAATELKAKGGYLLAAMNVERQENAPIRKLFNITGFPTLIYFENGKLRFTYEGD
NTKDALVAFMLNPNAKPTPKPKEPEWSADTNSEIVHLTNQGFEPALKDEKSALVMFYAPW
CGHCKRMKPEYEKAALEMKQQKIPGLLAALDATKEQSVAEKYKVKGYPTVKFFSYGVFKF
EVNVRDASKIVEFMRNPKEPPPPPPPEKNWEEEEDSKEVLFLDDETFSTTLKRKKHALVM
FYAPWCGHCKSTKPEFTAAATALQDDPRVAFAAVDCTKQAALCAKYNVRGYPTILYFSYL
KTRLDYNAGRTSKDFIAFVNNPPSAVDRTEL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggggatctccgcccagcttttttcgctcctcctgttgacggcacttgttgccgctaag
acaaaaacatcgcctgtccaggagaacattgccgagtacaaggactttaagaagctgcta
cgcaccaagaacaatgtcctggcactgtacgtgaccagtgcgaaggctgctgctgccgaa
ctgaaggtgtttcgggaggctgcggaggcgatacgcgggacagggacgatgatacttttg
gactgcggtcaagcggatcgtaagaagctgtgcaagaagctgaaggtatccccagatccc
tatgctattaagcactacaaagacggggactaccacaaggactatgaccggcaacttagt
gtcgcttcgatggtaacattcatgcgggatccctctggcgatttgccgtgggaggaggat
cccgccggggatgacgtcttgcactttagcgatgcaggctcctttacgaaacacctgcgg
aaggatatccggcccatgctggtcatgtttcatgtgccgtggtgtggattttgcaagaaa
atgaagccagattatggcaaggcagccacggaactgaaggccaaaggcggttatctcttg
gcggcgatgaacgttgagcggcaggaaaacgctccgatacgcaagttgttcaacataact
ggattccctactcttatatactttgaaaacggcaagctgcgcttcacctacgaaggggac
aacacaaaggatgcccttgtagctttcatgctaaacccgaatgccaagcccacgccaaag
ccaaaggagccggagtggtcggcagatacgaactccgaaatagtgcacctaaccaaccaa
ggctttgagcccgctctgaaggacgagaagtctgctttagtcatgttctacgctccctgg
tgtggccactgcaagcgcatgaagccagagtatgaaaaggccgctttggagatgaagcag
cagaagattccaggactgttggccgcgctggacgccacgaaggagcaatctgttgctgag
aagtacaaggtgaagggctaccccacggttaagtttttctcgtacggggtcttcaagttc
gaagttaatgtacgagacgcatcgaaaatagtcgagtttatgcggaatccgaaagaaccg
ccaccaccacctccgccggaaaagaactgggaagaggaggaggacagcaaggaggtgctt
ttccttgacgatgaaacctttagtacgacactaaagcgaaagaagcatgcactggtgatg
ttctacgctccctggtgcggccactgcaagagcacaaagccggagttcaccgcagccgcc
acagctttgcaggacgatcctcgggtggcatttgcggccgttgactgcaccaagcaggct
gctctctgcgccaagtataatgttcgcggctaccctaccattctctacttctcttacctt
aaaacaaggctggactacaacgctgggcgcaccagcaaggacttcatcgcattcgtgaac
aatccgccgagtgcggtagaccgtactgaactgtga

DBGET integrated database retrieval system