KEGG   Drosophila ananassae: Dana_GF21693Help
Entry
Dana_GF21693      CDS       T01059                                 

Definition
GF21693 gene product from transcript GF21693-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dan00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 297 aa AA seqDB search
MATTAAAMAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGAWSFGPQHGFARITRWHLERPPERLHNGDVEAIFSLMDNDFTRSIWNYQF
RISYRLILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
RENSLYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVTSPVILLPGTAFEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccacgacagcggccgcaatggccgccaccagcgttgtggtattggatcgcggcaac
aacacaacctgcaccattaacttgcatggcgccacagttgtctcctggcgtgtcaacaat
caggagcagttgtttgtcagcaagctggcctcgttcgatggcaagaaggcgatacgtggc
ggaataccctttgtgtttccccagtttggagcatggtccttcgggccccagcacggattt
gcgaggattacccggtggcacttggagcgacctccggagaggctgcacaacggagatgtc
gaggctatattctcgctgatggataacgactttacacgctccatctggaactatcagttc
cgcatttcctaccgcttgatcctgcgggaaaaggagctccacttccacatcggcgtctac
aaccccagcaaggagctgagcttcactttcaatatgctgctgcacacatacctgaaggtg
cccgatgtccggcggtgtcagatcacaggcctgcagggctgccacttcatcgacaagacg
cgggagaactccctctaccaggagggacgcgaggtggtcacagtgaacgagtggaccgac
aggatctaccagcacaccccgcaggagcacgtcatcaccaatgtggtgtccggccgcaag
atgcgactgcacaaatacaatttccccgatacggtcatctggaatccttggatcgatcga
tcgcgtgaaatgagtgactttggcgatgacgagttccccaacatgctgtgcgtggaggcg
ggcaatgtgacctcccccgtgatcctgttgccgggcacagccttcgaggccagtcagatc
cttcagatcatcatcgagggcaatgttagtcgcaagaccaagcggaatcgctag

DBGET integrated database retrieval system