KEGG   Drosophila ananassae: Dana_GF21892Help
Entry
Dana_GF21892      CDS       T01059                                 

Definition
GF21892 gene product from transcript GF21892-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dan  Drosophila ananassae
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dana_GF21892
   04340 Hedgehog signaling pathway
    Dana_GF21892
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dana_GF21892
Protein kinases [BR:dan01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dana_GF21892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 495 aa AA seqDB search
MDTEEEEEEDKEEEATIVRARFLKKKKSHHSSASGEGKLQAQSSCEEEGGAAGAGAAADQ
ASSSSSGPSAAAAAASQKSTPPAATSSQPTSGAEASGSGSGGGGGGGASGSGSSQDHQSD
QQAQVSASATFRLSSLTGTISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPT
NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRIL
QAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFE
YLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGY
NKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQV
DLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEAL
RISSTEKCAKEFAEF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggatacagaagaagaagaagaagaggacaaggaggaggaggccaccattgtgcgtgcg
agattcttaaaaaagaaaaagtcccatcatagttcggcatccggcgagggcaagctacag
gcgcagtccagttgcgaggaggagggcggagcggcaggagcgggagcggcagcggaccag
gctagcagcagcagcagcggcccatcggcagcagccgccgccgccagccagaagagcacg
ccccccgcagccacgagctcgcagcccacttcgggagcggaagccagcggatcaggtagt
ggtggaggaggaggaggaggagcatccggttccggttcgagtcaggatcaccagtccgat
cagcaagctcaggtctcggccagcgccacgttccgtctatcctcgctaacgggcactatc
tccaagatgggcaacaacgcgaccacctcgaacaagaaggtcgacgccgccgagacggtg
aaggagttcctcgagcaggccaaggaggagttcgaggacaagtggcgccgcaatccgacc
aacaccgccgccctcgacgacttcgagcggatcaagacactgggcaccgggtcgttcggt
cgggtgatgatcgtccagcataagcccacgaaagactactacgccatgaagatcctcgac
aagcagaaggtggtcaagctgaagcaggtggagcacacgctgaacgagaagcgcatcctg
caggccatccagttccccttcctcgtctcgctgcgctaccacttcaaggacaactccaac
ctctacatggtactggagtatgtgcccggtggcgagatgttctcccacctgcgcaaggtg
ggccgcttctcggagccgcactcgcgcttctacgcggcgcagatcgtgctggccttcgag
tacctgcactacctggacctcatctaccgggatctgaagccggagaacctgctgatcgac
tcgcagggctacctcaaggtgacggacttcggcttcgctaagcgcgtcaaggggcgcacc
tggacgctgtgcggcacaccggagtacctggcgcccgagatcatcctatcgaagggctac
aacaaggccgtcgactggtgggcgctgggtgtgctcgtctatgaaatggcagccggctat
ccgccgttcttcgcggaccagccgatccagatctacgagaagatcgtgtccggcaaggtg
cgcttcccgtcgcactttggttcggatctgaaggacctgctgcgcaacctcctgcaggtc
gacctgaccaagcgctacggcaatctgaaggcgggcgtcaatgatattaagaaccagaag
tggttcgcctccaccgactggattgcgatcttccaaaagaaaatcgaggcgccgttcatt
ccgcggtgtaagggccccggcgatacgagcaatttcgacgactacgaggaggaggcgctg
cggatctccagcacagagaagtgcgccaaggagtttgctgaattctag

DBGET integrated database retrieval system