KEGG   Drosophila ananassae: Dana_GF21939Help
Entry
Dana_GF21939      CDS       T01059                                 

Definition
GF21939 gene product from transcript GF21939-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dan  Drosophila ananassae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dana_GF21939
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dana_GF21939
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dana_GF21939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MWWSRKLASRCLRLHRAKSTASEPEQTLGIIGVPFAKGQGKQGVELAPDLLRQSSLRQVL
QSSHDGLVIRDYGNLQYSVDESLLQQQRVHYHHIRNYADFMACNRALIEQVKEMLKENSQ
FLAIGGDHAIGFGSVAGHLQHTPDLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLR
TTWQHAGLQDIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIE
MTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDL
VEINPKLGSERDVRTTVESGLEILKSMFGYRRSGNWSNIDTGILGSD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaagttagcctcgagatgtctccgcctccacagggccaagagcacc
gcctcagagccggagcagacgctgggcatcatcggagtgcccttcgccaagggtcagggc
aagcagggcgtggaactggcaccggatctcctccggcagagcagtctgcggcaggtccta
caaagtagtcatgatggcttggttataagggactatggtaacctgcagtactccgtggac
gagtccttgctgcagcaacagcgcgtccactaccaccacatccggaactatgccgacttc
atggcctgcaaccgggcgctgatcgagcaggtgaaggagatgctcaaggagaactcccag
ttcctggccattggcggtgatcatgccatcggttttggttcggtggctggacatttacag
catacgccggatttatcgctggtgtggatcgatgcacatgcggacatcaatctgcatagc
acctcgcagtcgggcaacatccatggcatgcccgtgtcctttctattggagcagctgcgc
accacctggcagcatgccggcctccaggacatagctcccaactgtttgcccaaggatcag
ttggtttacatcggcctgagggacattgacccctacgaggcgttcatactgaacaaagtt
ggaatacgctactatgccatggatacaatcgatcgcgtgggagtgcccaagatcattgag
atgactctggatgcgctgaatccccagaacaagatccacgttagcttcgacatcgacgcc
ctggacagcaatgtggcgcctagcaccggtaccgccgtccggggcggtctcaccctccgc
gagggcatcagcatcgtggaggcactgcgggacaccaagcgggtccagggcgtggatctc
gtggagatcaatccaaagctgggcagcgagcgagatgttcgcaccaccgtcgagtccggc
ttggagatccttaagagcatgtttggctatcggagatccggaaactggagcaacatcgac
actggcatcctggggagcgattaa

DBGET integrated database retrieval system