KEGG   Drosophila ananassae: Dana_GF21998Help
Entry
Dana_GF21998      CDS       T01059                                 

Definition
GF21998 gene product from transcript GF21998-RA
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dan  Drosophila ananassae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dana_GF21998
Enzymes [BR:dan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dana_GF21998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1751 aa AA seqDB search
MTDYVELLNSMASTFNSDCATSTAEGGTLLNIDLAEDKTLKWRNLANNQFACKDKEKKQQ
QQNQQQQEDQEEEEAKGTEGEGAAEKQEKPDQEEDSTNSGEDLKEIKELLTHVVNSAAVK
LEEEAAAAEAEAEAETATATEALAETTTQAQGQNATEKAEENSEKLTEEQEKVQAAGAET
LGAKEQQQQQQEEEEGEGEKKETNERENEKEKQPQDAASSPITVKLEESGAVTVTVTVAN
ENANAVTSAEQQQSEIIKTEEEREKEAPQEEPEEEETPKQEPKENDDDDEEEEEDKKVDA
VALVQPEGVVAKERAEEEAAPAEKQEEQVSPGGTRRSRRTPRPTDTPTPTPTPTTPTPPI
TGDEPAPASSVDVPEVETEMQVESSVPIVEEVAVAGTTASAAAVELEVKKEPEKPATVTS
SPPEEVAPPPAPKRGRGRAKKIKPEVEVAEAPSEAPGGAGEDLAVVVERKQPGRKRKLPE
EHPPDQSLGDLVVVKTEHDDGGAADGSAPGGDAKRMRRSVRLGNRHPADGWEEVKTEPVP
PLADLSLLEVAPAAVAPVLLDGKTPPKKRGRKAKIQPGTKPDPAANLALTNGNKRATATG
PEVQLPKRSKRRIKPTPKILENDELRCEFETKHIERMTQWETAAGSSNGDFETPQSGVGG
GGGGGGGGGSCSSTSRQKSDKSDGSNFEGHPAGTSAIKKRLFSKSQRDIENASAALLAKS
KVRPCPNVEEFLSDIKAARFNANRSPEDRKLNKKQQRKLAKQKEKHLKHLGLKRNQSDEA
SDNDSSNTDNEFVPTTRVQVAKRSVTLRVRNTATKEVATTSAQALKAAATAAPQQLPPKL
TRRVGGRGATGAGGGSSPAAGVAVSTLDHAQLHSLNSSILADIPPINTDSDATPSTSTLA
KFICLCQKSSQYYARNAPESSYCCAIDHIDEQKIGCCNELSSEVHNLLRPSQRVGYMILC
DEHKKRLHSHNCCAGCGIFCTQGKFVLCKNQHFFHPDCAQRFILNSSCEGQWERGDRAKF
SSPVLVLKCPHCGCDTPERASTVTMKCQSLPVFLPTQKYKIKPAKLTTSSHLTQFGGGGA
GGGAKSSLAGKTKGKGSSSSSAAVGSVTPSSSSSSSASASATKTNGTRGGKISQSLNTIN
FEQLIPDSVMNVVLRGHVVSASGRVTTEFTSRDMYYAVQNDDLERVAEILAADFNVLTPI
REYPNGTCLHLVAHSGTLQMAYLLLCKGASSQDFVNIVDTELRTALMCAVMNEKCDMLNL
FLQCGADVAIKGPDGKTSLHIAAKLGNVEATQLIVESYRASKNITSFLSFIDAQDEGGWT
AMVWAAELGHTDIVSFLLNQGADPNICDNDNNTVLHWSTLHNDGLDTITVLLQAGADCNV
QNVEGDTPLHIACRHSVTRMCIALIANGADLMIKNKAEQLPFDCIPNEESECGRTVGFNM
QMRSFRPLGLRTLVACADASNGREVRPIQAVRNELAMSESEDEADSLLWPDFRYVTQCII
QQNSVQIDRRVSQMRICSCPDSCSSDRCQCNGASSQNWYTAESRLTSDFNYEDPAVIFEC
NDVCGCNQLSCKNRVVQNGTRTPLQIVECEEPSKGWGVRALANVPKGTFVASYTGEILTA
MEADRRTDDSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLAVRVFYEHQDYRFPKIAF
FACRDIDAGEEICYDYGEKFWRAEHRSNLGCRCLTASCKYATQSSSTNGSPMDTAGDAVD
PEPDTDHLDSK
NT seq 5256 nt NT seq  +upstreamnt  +downstreamnt
atgacggactatgtggagctgttgaacagcatggccagtaccttcaactcggactgtgcc
acttccacggccgaggggggcactctcctcaatattgacctggccgaggataagaccctc
aaatggcgcaatctggccaacaatcagtttgcctgcaaggacaaggagaagaagcagcag
caacagaatcagcagcagcaggaggaccaggaggaggaggaggccaaaggcacagaggga
gagggagcggcagagaagcaggagaagcctgaccaggaggaggattcaacaaactctggc
gaggatttgaaggaaatcaaggaacttctaacacatgttgttaattccgctgccgtcaag
ctggaagaggaagcagcggcagcagaagcagaagcagaggctgagacagcgacagcgact
gaggcgctggcagagaccacaacgcaggctcaaggccaaaatgcaaccgaaaaagcagaa
gaaaattctgaaaaactaaccgaagagcaggaaaaagtgcaagcagctggcgctgaaact
ttgggggccaaggaacaacaacaacaacaacaagaagaagaagagggagagggagagaag
aaagaaaccaacgaaagagagaatgaaaaggagaagcagccgcaggatgcggcaagtagc
cccataacggtaaagctggaagagagcggcgcagttacagttacagttacagttgcaaat
gaaaatgcaaatgcagtgacgtcggcagagcagcagcagagcgaaatcatcaagactgag
gaagagagggagaaggaagctccgcaggaagagccggaggaagaggaaacccccaaacag
gaaccaaaagaaaacgatgatgatgatgaagaagaagaagaagataagaaggtagatgca
gtggcgctggtgcagcccgagggggtggtggcaaaggagagagccgaagaggaggcggcg
cctgccgaaaagcaggaagaacaagtatccccgggcggaacccgacgttctcggaggact
ccccgtcccacggacacgcccacgcccacccccacccccacaacacccacgccacccatc
accggtgatgagccagcacctgcctcgtcggtggacgtccccgaggtggagacagagatg
caggtggagtcgagtgtgccaatcgtcgaggaggtggctgtggcaggaacaactgcctct
gcagcagccgtcgagctggaggtgaagaaggagccggagaaaccagccaccgtgacatca
tcgccccccgaggaggttgcgccgccaccggctcccaagcggggcagaggacgtgccaaa
aagataaagccggaggtggaggtggcggaggcgccgagcgaagcacctggcggagctgga
gaggacctggcagtggtggtggagaggaagcagccgggcaggaagcggaagctgccggag
gagcacccgcccgaccagtcgctgggcgatctcgtggtggtcaaaacggagcacgacgac
ggaggagctgcagacgggtctgctcccggcggggatgccaagcgaatgcgccggagtgtc
cggctgggcaaccgtcatcccgccgacggatgggaggaggtaaagacagagcccgttccc
ccgctggcggatctgtccctgctggaggtggctcctgctgccgtggcgccggttctcctg
gacgggaagacgccgccgaagaagcgcggcaggaaggccaagatccagcccggcactaag
cccgatccggcagccaatctggctctcaccaatggcaacaagcgggcgactgccactggg
ccggaggtccagctgccgaagcgctccaagcgacggatcaagcccactccgaagatcctg
gagaacgatgagctgcgctgcgagttcgagacgaagcacattgaacggatgacccagtgg
gagacggcggccggctcctcgaacggcgactttgagacgccccagtcgggagtgggaggc
ggtggaggtggtggtggcggtggaggatcttgctcctccacgtcgcggcagaagagcgac
aaatcggatggcagcaacttcgaggggcatccggccgggacgagtgccatcaagaagcgt
ctcttctccaagtcccagcgggacatcgagaacgccagcgccgccctgctggcgaagagc
aaggtgcggccgtgtcccaacgtggaggagttcctcagcgacatcaaggcggcccggttc
aacgccaaccgatccccggaggatcggaagctgaacaagaagcagcagcgcaagctggcc
aagcagaaggagaagcacctgaagcatctcggcctgaagcgcaaccaaagcgacgaggcc
tccgacaacgacagctccaacacggacaacgagttcgtgcccaccacccgcgtccaggtg
gccaagcgcagtgtcaccctgcgtgtccggaacactgccaccaaggaggtggccaccaca
tccgcacaggccctgaaagcagccgccacggctgccccacagcaactcccacccaagcta
actcgtcgcgtcggtgggcgaggtgcgactggagcaggaggtggctcctcgccagccgct
ggcgtggccgtttccacgctggaccatgcccagctgcactcgctgaactcctcgatcctg
gccgacataccgcccatcaacaccgactcggacgccacgccgagcacctcaactcttgcc
aagttcatctgcctctgccagaagagttcgcagtactatgcgcggaacgcccccgaatcc
tcctactgctgtgccatcgaccacattgacgagcagaagatcggctgctgcaacgagctc
tcctccgaggtgcacaacctcctccgtcccagccagcgcgtcggctacatgatcctctgc
gacgagcacaagaagcgactccactcccacaactgctgtgccggctgcggcatcttctgc
actcagggcaagtttgttctctgcaagaatcagcactttttccacccggactgcgcccag
cgcttcatcctcaactcgtcctgcgagggccagtgggagcgcggagatcgggccaagttc
agcagccctgtgctggtgctcaagtgtccgcattgcggatgcgacactccggagcgcgcc
tccacggtgaccatgaagtgccagtcactgcccgtttttctgcccacccagaagtacaag
attaaacccgccaagctgacgacttcgtcgcatctgacacagtttggcggaggaggagcg
ggcggcggtgccaagtccagtcttgctggcaaaaccaaaggcaaaggctcctcctcatcc
tccgccgccgtgggctctgtcacgccctcctcctcatcatcatcctcggcctccgcctca
gcgacgaagaccaatggaactcgtggcggaaaaatcagccaatccctcaacacgatcaac
tttgaacagctcattcccgactcggtgatgaatgtggtgctgcggggccatgtggtgtcg
gccagtggtcgggtcaccaccgagttcacctcccgggacatgtactatgccgttcagaac
gatgatctcgaaagggtggccgagattctagctgccgacttcaatgtgttaactcccatc
agggagtatccaaatggaacctgcctgcatctggtggcccattcgggcacacttcagatg
gcctatctgctgctctgcaagggcgccagctcccaggactttgtcaacatcgtggacacc
gagctgcgcacggccctgatgtgcgcggtgatgaacgagaagtgcgacatgcttaatctc
ttcctgcagtgcggagccgatgtggccattaagggaccggatggcaagaccagtctccat
attgccgccaaactgggcaacgtggaggccacccaactcatcgtggagagctatcgcgcc
tcgaagaacatcaccagcttcctgagcttcatcgacgcccaggatgagggcggctggacg
gccatggtgtgggcagctgagctgggacacaccgatattgttagtttccttctgaatcag
ggcgctgatcccaacatctgcgacaatgacaacaacacggtgctccactggtccaccttg
cacaatgatggcctggacaccatcacggtactgctgcaggctggcgccgattgcaatgtc
cagaacgtggaaggggacacgccactccacattgcctgccgccactcggtcactaggatg
tgcatcgctttgatcgccaatggagcggatctgatgatcaagaacaaggccgaacagctg
cccttcgattgcattcccaacgaggagtcggaatgcggccgcaccgtcggcttcaacatg
cagatgcgcagtttccggcccctgggcctccgcacccttgtcgcgtgcgccgatgcctcc
aacggacgcgaggtccggcccatccaggcggtgcgcaacgagctggccatgtcggagagc
gaggatgaggcggactccctgctctggccggactttcgctacgtcacccagtgcatcatc
cagcagaactcggtgcagatcgatcggcgggtctcgcagatgcgcatctgctcctgcccg
gacagctgcagcagcgacaggtgccagtgcaacggtgcctcctcccagaactggtacacg
gccgagagccgtctcacctccgacttcaactacgaggatccggcggtgatcttcgagtgc
aacgacgtctgcggctgcaaccagctctcgtgcaagaaccgtgtggtccagaacggcact
cgaactccccttcagatcgtcgagtgcgaggaaccatccaagggatggggcgttcgggct
ttggccaacgtgcccaagggcacttttgtggccagctacacgggcgagatcctgacggct
atggaagccgataggcgcacggacgatagctactacttcgatctggacaacgggcactgc
atcgatgccaactactacggcaatgtgacgcgcttcttcaaccactcctgcgagccgaac
gtcctggcggtgcgggtgttctacgagcaccaggactaccgcttccccaagatagcattc
ttcgcctgccgcgacatcgacgccggcgaggagatctgctatgattatggagagaagttc
tggcgggccgagcatcgctccaacttgggctgccgctgcctgacggcctcctgcaagtac
gccacccaatcctccagcacaaatggctctccgatggacacggccggagatgcagttgat
cctgaaccggatacggatcaccttgactcgaaatga

DBGET integrated database retrieval system