KEGG   Drosophila ananassae: Dana_GF21998Help
Entry
Dana_GF21998      CDS       T01059                                 

Definition
(RefSeq) GF21998 gene product from transcript GF21998-RB
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dan  Drosophila ananassae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dana_GF21998
Enzymes [BR:dan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dana_GF21998
Chromosome [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dana_GF21998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1758 aa AA seqDB search
MTDYVELLNSMASTFNSDCATSTAEGGTLLNIDLAEDKTLKWRNLANNQFACKDKEKKQQ
QQNQQQQEDQEEEEAKGTEGEGAAEKQEKPDQEEDSTNSGEDLKEIKELLTHVVNSAAVK
LEEEAAAAEAEAEAETATATEALAETTTQAQGQNATEKAEENSEKLTEEQEKVQAAGAET
LGAKEQQQQQQEEEEGEGEKKETNERENEKEKQPQDAASSPITVKLEESGAVTVTVTVAN
ENANAVTSAEQQQSEIIKTEEEREKEAPQEEPEEEETPKQEPKENDDDDEEEEEDKKVDA
VALVQPEGVVAKERAEEEAAPAEKQEVNAGAAEEQVSPGGTRRSRRTPRPTDTPTPTPTP
TTPTPPITGDEPAPASSVDVPEVETEMQVESSVPIVEEVAVAGTTASAAAVELEVKKEPE
KPATVTSSPPEEVAPPPAPKRGRGRAKKIKPEVEVAEAPSEAPGGAGEDLAVVVERKQPG
RKRKLPEEHPPDQSLGDLVVVKTEHDDGGAADGSAPGGDAKRMRRSVRLGNRHPADGWEE
VKTEPVPPLADLSLLEVAPAAVAPVLLDGKTPPKKRGRKAKIQPGTKPDPAANLALTNGN
KRATATGPEVQLPKRSKRRIKPTPKILENDELRCEFETKHIERMTQWETAAGSSNGDFET
PQSGVGGGGGGGGGGGSCSSTSRQKSDKSDGSNFEGHPAGTSAIKKRLFSKSQRDIENAS
AALLAKSKVRPCPNVEEFLSDIKAARFNANRSPEDRKLNKKQQRKLAKQKEKHLKHLGLK
RNQSDEASDNDSSNTDNEFVPTTRVQVAKRSVTLRVRNTATKEVATTSAQALKAAATAAP
QQLPPKLTRRVGGRGATGAGGGSSPAAGVAVSTLDHAQLHSLNSSILADIPPINTDSDAT
PSTSTLAKFICLCQKSSQYYARNAPESSYCCAIDHIDEQKIGCCNELSSEVHNLLRPSQR
VGYMILCDEHKKRLHSHNCCAGCGIFCTQGKFVLCKNQHFFHPDCAQRFILNSSCEGQWE
RGDRAKFSSPVLVLKCPHCGCDTPERASTVTMKCQSLPVFLPTQKYKIKPAKLTTSSHLT
QFGGGGAGGGAKSSLAGKTKGKGSSSSSAAVGSVTPSSSSSSSASASATKTNGTRGGKIS
QSLNTINFEQLIPDSVMNVVLRGHVVSASGRVTTEFTSRDMYYAVQNDDLERVAEILAAD
FNVLTPIREYPNGTCLHLVAHSGTLQMAYLLLCKGASSQDFVNIVDTELRTALMCAVMNE
KCDMLNLFLQCGADVAIKGPDGKTSLHIAAKLGNVEATQLIVESYRASKNITSFLSFIDA
QDEGGWTAMVWAAELGHTDIVSFLLNQGADPNICDNDNNTVLHWSTLHNDGLDTITVLLQ
AGADCNVQNVEGDTPLHIACRHSVTRMCIALIANGADLMIKNKAEQLPFDCIPNEESECG
RTVGFNMQMRSFRPLGLRTLVACADASNGREVRPIQAVRNELAMSESEDEADSLLWPDFR
YVTQCIIQQNSVQIDRRVSQMRICSCPDSCSSDRCQCNGASSQNWYTAESRLTSDFNYED
PAVIFECNDVCGCNQLSCKNRVVQNGTRTPLQIVECEEPSKGWGVRALANVPKGTFVASY
TGEILTAMEADRRTDDSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLAVRVFYEHQDY
RFPKIAFFACRDIDAGEEICYDYGEKFWRAEHRSNLGCRCLTASCKYATQSSSTNGSPMD
TAGDAVDPEPDTDHLDSK
NT seq 5277 nt NT seq  +upstreamnt  +downstreamnt
atgacggactatgtggagctgttgaacagcatggccagtaccttcaactcggactgtgcc
acttccacggccgaggggggcactctcctcaatattgacctggccgaggataagaccctc
aaatggcgcaatctggccaacaatcagtttgcctgcaaggacaaggagaagaagcagcag
caacagaatcagcagcagcaggaggaccaggaggaggaggaggccaaaggcacagaggga
gagggagcggcagagaagcaggagaagcctgaccaggaggaggattcaacaaactctggc
gaggatttgaaggaaatcaaggaacttctaacacatgttgttaattccgctgccgtcaag
ctggaagaggaagcagcggcagcagaagcagaagcagaggctgagacagcgacagcgact
gaggcgctggcagagaccacaacgcaggctcaaggccaaaatgcaaccgaaaaagcagaa
gaaaattctgaaaaactaaccgaagagcaggaaaaagtgcaagcagctggcgctgaaact
ttgggggccaaggaacaacaacaacaacaacaagaagaagaagagggagagggagagaag
aaagaaaccaacgaaagagagaatgaaaaggagaagcagccgcaggatgcggcaagtagc
cccataacggtaaagctggaagagagcggcgcagttacagttacagttacagttgcaaat
gaaaatgcaaatgcagtgacgtcggcagagcagcagcagagcgaaatcatcaagactgag
gaagagagggagaaggaagctccgcaggaagagccggaggaagaggaaacccccaaacag
gaaccaaaagaaaacgatgatgatgatgaagaagaagaagaagataagaaggtagatgca
gtggcgctggtgcagcccgagggggtggtggcaaaggagagagccgaagaggaggcggcg
cctgccgaaaagcaggaagtaaacgccggagctgcagaagaacaagtatccccgggcgga
acccgacgttctcggaggactccccgtcccacggacacgcccacgcccacccccaccccc
acaacacccacgccacccatcaccggtgatgagccagcacctgcctcgtcggtggacgtc
cccgaggtggagacagagatgcaggtggagtcgagtgtgccaatcgtcgaggaggtggct
gtggcaggaacaactgcctctgcagcagccgtcgagctggaggtgaagaaggagccggag
aaaccagccaccgtgacatcatcgccccccgaggaggttgcgccgccaccggctcccaag
cggggcagaggacgtgccaaaaagataaagccggaggtggaggtggcggaggcgccgagc
gaagcacctggcggagctggagaggacctggcagtggtggtggagaggaagcagccgggc
aggaagcggaagctgccggaggagcacccgcccgaccagtcgctgggcgatctcgtggtg
gtcaaaacggagcacgacgacggaggagctgcagacgggtctgctcccggcggggatgcc
aagcgaatgcgccggagtgtccggctgggcaaccgtcatcccgccgacggatgggaggag
gtaaagacagagcccgttcccccgctggcggatctgtccctgctggaggtggctcctgct
gccgtggcgccggttctcctggacgggaagacgccgccgaagaagcgcggcaggaaggcc
aagatccagcccggcactaagcccgatccggcagccaatctggctctcaccaatggcaac
aagcgggcgactgccactgggccggaggtccagctgccgaagcgctccaagcgacggatc
aagcccactccgaagatcctggagaacgatgagctgcgctgcgagttcgagacgaagcac
attgaacggatgacccagtgggagacggcggccggctcctcgaacggcgactttgagacg
ccccagtcgggagtgggaggcggtggaggtggtggtggcggtggaggatcttgctcctcc
acgtcgcggcagaagagcgacaaatcggatggcagcaacttcgaggggcatccggccggg
acgagtgccatcaagaagcgtctcttctccaagtcccagcgggacatcgagaacgccagc
gccgccctgctggcgaagagcaaggtgcggccgtgtcccaacgtggaggagttcctcagc
gacatcaaggcggcccggttcaacgccaaccgatccccggaggatcggaagctgaacaag
aagcagcagcgcaagctggccaagcagaaggagaagcacctgaagcatctcggcctgaag
cgcaaccaaagcgacgaggcctccgacaacgacagctccaacacggacaacgagttcgtg
cccaccacccgcgtccaggtggccaagcgcagtgtcaccctgcgtgtccggaacactgcc
accaaggaggtggccaccacatccgcacaggccctgaaagcagccgccacggctgcccca
cagcaactcccacccaagctaactcgtcgcgtcggtgggcgaggtgcgactggagcagga
ggtggctcctcgccagccgctggcgtggccgtttccacgctggaccatgcccagctgcac
tcgctgaactcctcgatcctggccgacataccgcccatcaacaccgactcggacgccacg
ccgagcacctcaactcttgccaagttcatctgcctctgccagaagagttcgcagtactat
gcgcggaacgcccccgaatcctcctactgctgtgccatcgaccacattgacgagcagaag
atcggctgctgcaacgagctctcctccgaggtgcacaacctcctccgtcccagccagcgc
gtcggctacatgatcctctgcgacgagcacaagaagcgactccactcccacaactgctgt
gccggctgcggcatcttctgcactcagggcaagtttgttctctgcaagaatcagcacttt
ttccacccggactgcgcccagcgcttcatcctcaactcgtcctgcgagggccagtgggag
cgcggagatcgggccaagttcagcagccctgtgctggtgctcaagtgtccgcattgcgga
tgcgacactccggagcgcgcctccacggtgaccatgaagtgccagtcactgcccgttttt
ctgcccacccagaagtacaagattaaacccgccaagctgacgacttcgtcgcatctgaca
cagtttggcggaggaggagcgggcggcggtgccaagtccagtcttgctggcaaaaccaaa
ggcaaaggctcctcctcatcctccgccgccgtgggctctgtcacgccctcctcctcatca
tcatcctcggcctccgcctcagcgacgaagaccaatggaactcgtggcggaaaaatcagc
caatccctcaacacgatcaactttgaacagctcattcccgactcggtgatgaatgtggtg
ctgcggggccatgtggtgtcggccagtggtcgggtcaccaccgagttcacctcccgggac
atgtactatgccgttcagaacgatgatctcgaaagggtggccgagattctagctgccgac
ttcaatgtgttaactcccatcagggagtatccaaatggaacctgcctgcatctggtggcc
cattcgggcacacttcagatggcctatctgctgctctgcaagggcgccagctcccaggac
tttgtcaacatcgtggacaccgagctgcgcacggccctgatgtgcgcggtgatgaacgag
aagtgcgacatgcttaatctcttcctgcagtgcggagccgatgtggccattaagggaccg
gatggcaagaccagtctccatattgccgccaaactgggcaacgtggaggccacccaactc
atcgtggagagctatcgcgcctcgaagaacatcaccagcttcctgagcttcatcgacgcc
caggatgagggcggctggacggccatggtgtgggcagctgagctgggacacaccgatatt
gttagtttccttctgaatcagggcgctgatcccaacatctgcgacaatgacaacaacacg
gtgctccactggtccaccttgcacaatgatggcctggacaccatcacggtactgctgcag
gctggcgccgattgcaatgtccagaacgtggaaggggacacgccactccacattgcctgc
cgccactcggtcactaggatgtgcatcgctttgatcgccaatggagcggatctgatgatc
aagaacaaggccgaacagctgcccttcgattgcattcccaacgaggagtcggaatgcggc
cgcaccgtcggcttcaacatgcagatgcgcagtttccggcccctgggcctccgcaccctt
gtcgcgtgcgccgatgcctccaacggacgcgaggtccggcccatccaggcggtgcgcaac
gagctggccatgtcggagagcgaggatgaggcggactccctgctctggccggactttcgc
tacgtcacccagtgcatcatccagcagaactcggtgcagatcgatcggcgggtctcgcag
atgcgcatctgctcctgcccggacagctgcagcagcgacaggtgccagtgcaacggtgcc
tcctcccagaactggtacacggccgagagccgtctcacctccgacttcaactacgaggat
ccggcggtgatcttcgagtgcaacgacgtctgcggctgcaaccagctctcgtgcaagaac
cgtgtggtccagaacggcactcgaactccccttcagatcgtcgagtgcgaggaaccatcc
aagggatggggcgttcgggctttggccaacgtgcccaagggcacttttgtggccagctac
acgggcgagatcctgacggctatggaagccgataggcgcacggacgatagctactacttc
gatctggacaacgggcactgcatcgatgccaactactacggcaatgtgacgcgcttcttc
aaccactcctgcgagccgaacgtcctggcggtgcgggtgttctacgagcaccaggactac
cgcttccccaagatagcattcttcgcctgccgcgacatcgacgccggcgaggagatctgc
tatgattatggagagaagttctggcgggccgagcatcgctccaacttgggctgccgctgc
ctgacggcctcctgcaagtacgccacccaatcctccagcacaaatggctctccgatggac
acggccggagatgcagttgatcctgaaccggatacggatcaccttgactcgaaatga

DBGET integrated database retrieval system