KEGG   Drosophila ananassae: Dana_GF22418Help
Entry
Dana_GF22418      CDS       T01059                                 

Definition
GF22418 gene product from transcript GF22418-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dana_GF22418
   04330 Notch signaling pathway
    Dana_GF22418
   04350 TGF-beta signaling pathway
    Dana_GF22418
   04630 Jak-STAT signaling pathway
    Dana_GF22418
   04068 FoxO signaling pathway
    Dana_GF22418
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF22418
Transcription factors [BR:dan03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dana_GF22418
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dana_GF22418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3297 aa AA seqDB search
MMADHLDEPPQKRPKMDPMTTDISLFLEENLPDELVSSNSGWSDQLTGGGGGGGGGGAPG
VNTNSTSGPNAGGGPNKPPAQGPGPGSGPGGVGVGVVGGVNVGVVGGVGVVPSQMNGAGG
GGGGGGGGGSNPGTGGDDGNGNGTGGGNAGPQIRQMQHHQQQLQHLLQQQQQQQGQKGAM
VVAGMQQLGSKSPNLQSPNQGGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQ
GNLGNMVLTNSVGGGMGGMVNQLKQQQPGGGGGAGGMINAVSVPGGPGGPGSGPGAGGGG
AVTPNQGMHMQNGPMMGRMVGQQHMLRGPHLMGAAGGAGGPGNGPGGGGPRMQTPNMQMG
QLNSLPYGVGQYGGPGGNNPQQQQQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPL
PTLGGDGSVSGGQLVGGNPQQQMLGQQPGAMGPRPPQPNQLLGHPGQQQQQPGTSQQQQQ
QQQQQQGVGGIVGGAGGGVVTGTVGGAGGGAGGVVTGAGGVATGGPGGGSRDVPDDRKRQ
IQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKAVLAHMGTCKQSKDCTMQHCASSR
QILLHYKTCINSACIICYPFRQNHSVFQNANVPPGGGGGSQVGGNAVVTGGGPVSAGPGG
AGGNSAGPGGPPGGIQQQQQQQQQQQQNQQPNLSGLVVDGKPGQQVAPGGGQNTAIVLPQ
QQQQQGGAGGGGGGAPGAPKTPQDMAQQLAQQQQQQVHQQQVQQQQELRRFDGMGQVGLS
PVTGGGMQQQQQGLPPTIRMQGAPPAVRVLGPGPGGPSGPNVLANDVNSLQQQQQQQQML
QQQQQGQNRRRGGGLPNMVDQQQQQQQQQQQQPNPSQLGGNIPAPLSVNVSGFGNANFGG
AGGATVPGNGPNDKQQLKVAQVHPQTHVVGAAGNAGAAGSGASGGPVGAPGSSSLMPADT
TGAGGGPNPGGNPNQNAGTGAGGGAGGGGGGGGSGTPGDNEKDWRESVTADLRNHLVHKL
VQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKELEEK
RLKRKEQHQQQIMQMQQQQATGGAGTPGGAGGVPTGGAGVGVGVGVGGGVLPQGQQGQPG
QQPGVQPGVRPIISPIGGVMPPQLRPQGPPGMVGQQPGVGVGVGVGVGVGVGVGVGGVTN
NMVTMRSHSPGGNMLTLQQQRMHFSQQPQPLNAVGGVGNMLVGPPGPSPGSMVVNPALSP
YQTGNVLTSPVPGQQPQPGQQQQQQQFINANGGSGAGNPQLSEIMKQRHIHQQQQQQQQQ
QQQGMLLPQSPFSNATPLQAGGNNFSSSLQQQQQQQQQQQQQQQQQQQPQQQQKPGSVLN
NMPPTPTSLEALNAGGGGGGGSGASGGATGAANSNATVSAPSPSPGFLSNGPSIGTPSNN
NNNNSSSSANNNPPSVSGMMQQPLSNRAATPPIHNIPIPASPAAAATGASGGLAANSTPA
SAAATCASSGSGSGSGSGSNSSSSGGATGSGAAVATTSATTPLSCASSSVATPTSATMAS
SSNSSAGGGGTGSGTATTPASNPLLLMSGGSGGGGGGGGGATSAATTTPSSTSSSRMMSS
SMSLSSQMAALEAAARDNDDETPSPSNENTNGSGGSGNAGGIASKGKLDSIKQEDDIKKE
FMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSCIKMEIKTEDGSEVKIKTEVMDVDEAG
GSAAGGGHHDGGAEGGTGKDNINGAHDGGAAGGSSVDIKPKTETKPLVPEPLAPNAGDKK
KKCQFNPEELRTALLPTLEKLFRQEPESVPFRYAVDPQALGIPDYFEIVKKPMDLGTIRN
NIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCC
GRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTYCQKCFNDIQGDTVT
LGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDN
CLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEV
KPGMRRRFVESGEMMQEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYI
AYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQ
KIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEE
SIKELDQEEEEKRKQAEAAEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKN
SKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGR
DAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNNCKTAVETRYHCTVCD
DFDLCIVCKEKVGHPHKMEKLGFDIDDGSAPADHKQANPQEARKQSIQRCIQSLVHACQC
RDANCRLPSCQKMKRVVQHTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCPN
IKHKLKQQQLQQKLQQQQLLRRRVALMSRTCPAPAAMSGSTAVSGPAVVASGVPVVGMSG
VAVSQQVMPGQAAIMPPGAGGMSPSTVTVPSPVSGGGAGANAMAGMTSPHPHQPGIGMKP
GGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPGMNRPLGGAGGGVPNQNVN
QLGGMGVGVGVGGVGSGVGVGGVGVNQLGGGGGGGPTGGPGGPGGVPGGAGNCGNVLNAN
NLLSMDQWGGGGGGGGNPGAGGNPQARYANNTTGMRQPNQLIQQQQQQNLLSQQQLQQQQ
MMALGGPNQMGGGGGGQMPVGGQHGGMGMGGMGAPTMAGAGAGGVRPPPGAGGGGGGGGQ
ASGSLNTQQLAQIMQKIKNNPNNESNQHILTILKQNPQIMAAIIKQRQQSHQSQINAAAA
AGGGGAGGAGGALGQQQQQQQQQQAGNGPQNPQQQQQQQQQQQQQQVMQQQQMQHMMNPN
QQMNPNQQQQQQQQVNLMQQGGPGGPGPHQRMPNMQNAMMLQNLPPGVTTQGGMVPNQNW
KQMRYMPMNQYPPPYQQRQRGPHMGGPGGGPGPGQQQFPVGSGGGAGNFNAGGAVGGGGG
GPGGDQYSMANAAAAAASNMLQQQGQVGVGVGGVGVGVGVGVGQGPPHDGMHNHGMHHQS
PLPGVPQDVGVGVGVGVGVGVGVGVGVGVGNVGVGVGNAGGALPDASDQLTKFVERL
NT seq 9894 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgcctcagaagcggcccaaaatggatccaatgacc
acggacatctccttgttcctggaggagaacctgccggacgagttggtgtcctcgaatagc
ggctggtcggatcagttgaccggcggcggcggcggcgggggcggcggcggtgcccccgga
gttaatacaaattccacctccggaccaaatgccggcggcggaccaaataagccacctgcc
cagggacctggacccggttctggacccggcggtgttggtgtcggagtcgtcggcggcgtt
aatgttggcgtcgtcggcggcgtcggcgttgtgccttcccagatgaacggagccggcggt
ggcggtggcggcggcggcggcggcggcagcaatcccggcactggcggtgatgatggtaac
ggtaatggaaccggtggcggtaatgccggaccacagatacgccaaatgcaacaccatcaa
caacagctgcagcatctgctccagcagcagcagcagcagcagggccagaagggcgccatg
gtggtcgccgggatgcagcaactgggcagcaagtcgcccaatctgcagagtcccaaccag
ggcggcatgcagcaggtggtgggcacacagatgggcatggtcaactcgatgcccatgtcc
atatcgaataacggcaacaacggaatgaatgccataccaggcatgaacaccatcgcccag
ggcaatctgggcaacatggtgctgacgaacagcgttggcggcggaatgggcggaatggtc
aaccagctgaagcaacagcagccgggcggcggcggcggtgccggcggcatgatcaacgct
gtatccgtacctggtggcccgggcggacccggctcgggcccgggagcgggtggcggcggc
gcagtcacacccaaccagggcatgcacatgcagaacggaccgatgatgggccggatggtg
ggccagcagcacatgctacgcggtccccatctcatgggagcggcgggcggtgccggagga
cccggcaatggacccggaggcggaggaccacgcatgcagacgcccaacatgcagatggga
caactgaacagcctgccctatggagtgggccagtatggcggacccggcggcaacaatccc
cagcagcagcagcagcaacagcagcagcagcagctcctggcccagcaaatggcccagagg
ggcggcgtggtgccgggcatgccccagggcaaccggcccgtgggcactgtcgtcccactg
ccgactctcggcggcgatggttccgtatccggtggccagctggtgggcggtaatccgcaa
caacagatgcttggccagcagccgggtgcgatgggcccgaggccgccacaacccaatcaa
ctgctggggcatcctggccagcagcaacagcagccaggcacatcccaacaacaacaacaa
caacagcaacagcagcaaggtgttggtggcattgttggtggtgctggtggtggtgtagtg
accggaacagttggcggtgccggtggcggagctggcggtgtggtcactggtgcgggtggc
gtggcgacaggcggtccaggtggcggcagtcgcgatgtacccgacgaccggaagcggcag
atccaacagcagttgatgctcctcctccatgcccacaagtgcaaccggcgggagaacctc
aatccgaaccgtgaggtgtgcaatgtgaactactgcaaggccatgaaggccgtcctcgcc
cacatgggtacctgtaagcagagcaaggactgcaccatgcaacactgcgcctcctcgcgc
cagatcctgctccactacaagacctgcataaacagcgcctgcatcatctgctatcccttc
cggcagaatcattcggtgttccagaacgccaatgtaccgcccggcggcggtggtgggtct
caggttggcggcaatgccgttgtgaccggtggtggcccagtttccgctggacctggcggt
gctggtgggaatagtgctggacctggtggaccacccggtggcatccagcaacagcaacag
cagcagcagcagcagcaacagaaccaacagcccaatctgtctggcctggtggtggacggt
aagccgggccagcaagtggcgcccggtggtggccagaatacggccattgtactgccccaa
cagcaacagcagcagggcggagcgggtggcggcggtggcggcgctcccggagcaccaaag
acaccacaggacatggcccaacagctggcccagcagcagcagcagcaggtgcaccagcaa
caagtccagcagcaacaggagctgcgacgattcgacgggatgggccaggtgggactgtcg
ccggtgacgggtggtggcatgcaacagcagcaacaaggcctgccgcccaccatccgcatg
cagggcgccccaccggccgtcagggtgcttggccctggtcccggtggacccagtggaccc
aatgtcctcgccaacgatgtcaacagcctgcaacagcaacagcagcagcaacagatgctg
caacagcagcagcagggccagaaccgtagacgcggcggcggtctgcccaacatggtggac
cagcagcagcagcagcagcagcaacagcagcagcagcccaatccctcccagcttggcggc
aacattccagcaccgctctcggtgaacgtcagcggcttcggcaatgccaacttcggtggc
gccggcggagcaacagtgcccggcaacggccccaacgataagcagcaactgaaggtggcc
caagtccatccccagacccatgtggtgggggcggcgggcaatgccggtgcggcgggcagt
ggagcaagtggcggtccagtgggtgcgcccggttccagttccctaatgccggcggatacg
acgggcgccggtggtggcccaaatccgggcggtaatcccaaccagaatgccggcacagga
gcgggcggaggcgctggcggtggcggcggcggcggtggttccggtacacccggagacaac
gagaaggactggcgggaatcggtgacggccgatctgcggaatcatctcgtccataagctg
gtgcaggccatcttccccacctccgatcccaccacgatgcaggacaagcggatgcacaac
ctggtctcgtacgcggagaaggtcgagaaggacatgtacgagatggccaagtcgcgctcc
gagtactaccacctgctggccgagaagatctacaagatccagaaggagctggaggagaag
cggctgaagcgcaaggagcagcaccagcagcagatcatgcagatgcaacagcagcaggcg
acaggtggcgccggaacacccggtggcgccggtggtgtcccaactggcggagcgggtgtt
ggtgttggtgtcggagttggtggcggtgtcctgccgcaaggacaacagggccaaccgggc
caacagcccggagtccagcccggcgtccgacccatcatcagtcccattggcggtgtgatg
ccgccacagttgcgaccgcagggaccgcccggaatggtcggccagcagccgggtgtcggc
gtgggcgttggcgttggagtgggcgtgggagtcggagtgggcgtgggcggagtgaccaac
aacatggtgacgatgcgcagccactcgcccggcggcaacatgctaaccctgcaacagcaa
cggatgcacttctcccagcagccgcagcccctcaacgccgtcggcggtgttgggaatatg
ctggtgggtccacccggacccagtcccggtagcatggtcgtcaatcccgccctgtcgccc
taccagacgggcaatgtgctgacgagtccggtgcccgggcagcagccccagcccggccag
cagcagcagcagcagcagttcatcaatgcgaacggaggcagcggtgccgggaatccccag
ctgagcgagatcatgaagcagcgccacatccaccagcagcagcagcagcagcaacagcag
cagcaacagggcatgctcctgccacagtcgccgttcagtaatgccacgcccctgcaagcg
ggcggcaacaacttcagttcctccttgcaacagcagcagcagcagcaacagcagcagcag
cagcagcagcaacagcagcagcagccgcagcagcaacagaaaccgggcagtgtactgaac
aacatgccacccacgcccaccagcctggaggcgttgaatgcgggcggtggtggtggtggt
ggcagtggagccagtggaggagcaactggagcagccaactcgaatgcaactgtttcggcg
ccaagtccctcgcctggtttcctatccaatggaccatcgatagggacgccctcgaacaac
aacaacaacaacagcagcagcagcgccaacaacaacccgccctcggtgtccggaatgatg
caacagccgttgagcaatcgagccgccacaccacccatccacaacatacccatacccgca
tctccagcggcggcggcgaccggtgcctccggcggtctggcggcgaacagtacgccggca
tcggcggcagcgacatgtgccagcagtgggagtggcagcgggagcgggagtgggagcaac
agtagcagtagcggtggagcgaccggtagtggagcggctgtggccaccacatcggcgaca
acgccactcagctgtgcctcatcctcggtggcgacacccacatcggcgacaatggcttcc
agcagtaacagtagtgcgggaggtggaggaaccggcagcggtacggccaccacacccgcc
agcaatcccctgcttctgatgtccggcggcagtggcggcggcggcggaggaggaggagga
gcaaccagtgcagcaaccaccacaccttcctcgacgagcagcagccggatgatgagcagc
tccatgagcctgtcctcgcagatggccgcactggaggcggcggcccgcgataatgacgac
gagacgccctcgccctccaatgagaacaccaacggcagtggcggaagtggcaatgccggc
ggcatagcctccaagggcaagctggactccatcaagcaggaggacgacatcaagaaggag
ttcatggacgacagctgcggcggcaacaacgacagctcccagatggactgctccacgggc
ggtggcaagggcaagaacgtcaacaacgacggcaccagctgcatcaagatggagatcaag
acggaggacggctcggaggtcaagatcaagacggaggtgatggatgtggacgaggccggt
ggctctgcagcgggcggtggccatcatgatggcggcgccgaaggtggcactggcaaggac
aacatcaacggagcccatgacggtggcgcggctggtggcagttccgtggacattaagccc
aagacggagacgaagccactggtgccggagccactggctcccaatgctggcgacaagaag
aagaaatgccaattcaatccggaggaactgcgaactgccttgctgccgacgctggagaag
ctcttccggcaggagcccgaatccgtgccattccggtatgccgtggatccgcaggccctc
ggcattcccgattactttgagatcgtgaagaagccaatggatctgggaactatacggaac
aatatccagaatggcaagtacagtgatccctgggagtatgtcgacgatgtctggctgatg
ttcgacaatgcctggctctataatcgcaagacttcaagggtatatcgttactgtacaaag
ctatcggaggtatttgaggcggaaatagatccggtgatgcaggccctgggctactgttgc
ggccggaagtacaccttcaatccgcaagtactgtgctgttatggaaagcagctctgtacg
atcccaagggacgccaagtactatagctaccagaacagtctaaaggaatacggtgttgcc
tcaaatagatacacctactgccaaaagtgctttaacgacatccagggcgatacggtcaca
ctgggcgacgatcctctgcagtcacaaactcaaatcaaaaaggaccagttcaaggagatg
aagaatgaccacctggagctggagccgtttgtcgactgccaggagtgcggccggaaacag
caccagatctgcgtcctctggctggactcgatctggcccggcggcttcgtctgcgacaac
tgcctgaagaagaagaactcgaagcggaaggagaacaagttcaatgccaagcgcctgccc
accaccaagctcggtgtctacatcgagacccgagtgaacaacttcctcaagaagaaggag
gcaggagcgggcgaagtccatatccgtgtggtcagctcatccgacaagtgtgtggaggtg
aagcccggaatgcgacgtcgtttcgtggaatccggtgagatgatgcaggagttcccctac
cgggccaaggccctgttcgccttcgaggaggtggacggcatcgatgtctgtttctttggt
atgcacgtccaggagtatggatcggagtgtccggcaccgaacacccgacgtgtctacatc
gcctacctcgactcggtgcacttcttccgtccacggcagtatcgtacggctgtctaccat
gagatcctgctcgggtacatggactatgtgaagcagctgggctatacgatggcccatatc
tgggcgtgtccgccgtcggagggcgatgactatatcttccactgccatcccacggatcag
aagataccgaagccgaaacgactgcaggaatggtacaagaagatgctcgacaagggcatg
atcgagaggattattcaggactacaaggacatactcaagcaggccatggaggataagttg
ggatcggcggcggagttgccatactttgagggcgatttctggccaaatgtcctcgaggag
agcatcaaggagctcgaccaggaggaggaggagaaacggaaacaggccgaggcagccgaa
gcagcggcagcagctaatctcttctccatcgaggacaatgaggtcagtggcgatgggaag
aaaaagggccagaagaaggccaagaagtccaacaaatcgaaggccgcccaacgaaagaac
agcaaaaagtccaacgaacatcaatccggcaacgatctctccgccaagatctacgccacc
atggagaagcacaaggaggtcttcttcgtcatccgcctccattcggcccagtcggcggcc
agcttagcgcccattcaagatccagatcctttgctaacctgcgatctaatggacggacgc
gatgccttcctcactctggcccgcgataagcactttgagttctcctccctgcgccgtgcc
cagttctccactctctctatgctctacgagctccacaaccagggccaggacaagttcgtc
tacacctgcaacaactgcaagacggccgtggagacccgctaccactgcaccgtctgtgat
gacttcgatttgtgtattgtgtgcaaggagaaggtcggacatccgcacaagatggagaag
ctcggcttcgatatcgacgatggctcggcgccggcggatcacaagcaggccaatccccag
gaggcccggaaacagtccatccagcgatgcatacagtctctggtgcatgcgtgccagtgc
cgggatgccaactgccggctaccgtcctgccagaagatgaagcgcgtcgtccagcacacc
aagaactgcaagcggaagaccaatggcggatgtcccatctgcaagcagctgatagctctg
tgctgctaccatgccaagcactgtcaggagcagaagtgtccagtgcccttctgtcccaac
atcaagcacaagctcaagcagcagcagctccagcaaaaactccaacagcaacagttgctg
cgtcgtcgtgtggccctcatgtcccgcacctgcccggcacccgccgccatgtccggctcg
acggcagtcagcggcccggccgtggtcgccagcggagtgcccgtggtgggcatgtccggc
gtggcggttagccagcaagtgatgcccggccaggcggccataatgccaccgggcgctggt
ggcatgtcgccttcaacggtgacagttccatctccagtctcgggcggaggagccggagcc
aatgccatggcgggcatgacgtctccccatccccaccagccgggtatcggcatgaagccc
ggcggtggccactccccgtccccgaacgtactccaggtagtgaagcaggtccaggaggag
gcggcccgccagcaggtctcgcacggcggtggcttcggcaagggagtgcccatggcgccg
ccgggaatgaaccgtccactaggcggagccggcggcggagtgcccaaccagaatgtcaac
cagctgggcggcatgggcgtgggtgtcggcgtgggcggagtcggtagcggagtcggtgtc
ggcggagttggtgtcaaccagctgggcggcggcggaggcggtggtccgacaggaggaccc
ggaggaccgggcggtgtcccgggcggtgccggtaactgcggcaacgtcctcaacgccaac
aacctgctctcgatggaccagtggggtggaggcggaggcggcggcggtaatcccggcgcc
ggtggcaatccccaggcccgctacgccaacaacacgaccggaatgcggcagcccaaccag
ctcatccagcagcagcagcagcagaacctgctctcccaacagcagctccagcagcagcag
atgatggccctcggtggcccgaatcagatgggtggcggcggtggcggccaaatgcccgtt
ggcggccagcacggcggcatgggtatgggtggaatgggtgcaccgacaatggcgggcgcc
ggagcgggtggagttcgaccaccgcccggtgccgggggcggaggcggcggtggcggccaa
gcctctggtagcctgaacacccagcaactggcccagatcatgcagaagatcaagaacaat
ccgaacaacgagagcaaccagcacatcctcaccattctgaagcagaatccccagatcatg
gccgccatcatcaagcagcgccagcagagccaccagtcccagatcaatgctgccgcggca
gcgggcggtggaggagctggtggagccggcggtgccctcggccagcagcagcaacagcag
cagcagcagcaggccggcaatgggccacaaaatccgcagcagcagcagcaacaacagcag
caacagcagcagcaacaggtgatgcagcaacagcagatgcaacacatgatgaaccccaac
cagcagatgaatcccaaccagcagcagcagcagcagcagcaggtgaacctcatgcagcag
ggcggcccggggggaccaggtccccaccagcggatgcccaacatgcagaacgccatgatg
ctgcagaacctgccgcctggagtcaccacccaaggaggcatggtgcccaaccagaactgg
aagcagatgcgctacatgccgatgaaccagtacccgccgccctaccagcagcgccagcgc
ggcccccacatgggcggccccggcggcggcccaggacccggccagcagcagttcccggta
ggcagcggcggcggagcgggcaacttcaatgccggcggtgccgtcggcggcggcggtgga
ggtcctggcggcgatcagtactccatggccaatgcggcagcggcagcagcctccaacatg
ctccagcagcagggtcaggtgggcgtcggagtgggcggagtcggagtgggcgttggagtc
ggcgtgggacaaggaccgccgcacgacgggatgcacaatcatggcatgcaccatcagtcg
ccgctgcccggcgtcccccaggacgtcggcgttggtgtgggtgtgggcgtgggcgtgggc
gtcggtgtcggcgttggtgtcggtgtggggaatgtgggcgtgggtgtggggaatgcggga
ggagcactgcccgatgcctccgatcagctgacaaagtttgtggagcggctctag

DBGET integrated database retrieval system