KEGG   Drosophila ananassae: Dana_GF22547Help
Entry
Dana_GF22547      CDS       T01059                                 

Definition
GF22547 gene product from transcript GF22547-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dan  Drosophila ananassae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dana_GF22547
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dana_GF22547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 644 aa AA seqDB search
MTANEAISEETMLRKQSITPPETSTPSPSPSPSTPTPTTISASDSELSEIFFVENSRRKQ
SIKIQVKLCPEGVYLRRETDEDDHINEQLIRIDDIIGSRYGPRLKKRARGGLNSCKNPNG
PGQEAAPEPDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLKTAETWHRTI
RQHKRSNGSSSPADTGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEAQYDLQITTHPQ
YAKEFVRTRKDLLERYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNG
LARSVAHHCNEPYEPKPILNATLTCIAGKSTPMDVVRIELAPGGDKHYVMYSFLSVGWGL
IADIDIESERLRSIGAQRFTLWAIKRLITLRTYKGKVYYLRATATPPKKSEPVVEMAREA
EENPQANRSSLPEFQDLPEEDELDADHFADAISLDRSVYRQHADSWHSAMSRRTAYYSLG
GPSLRSNRSRMSITQRIEAANAEFAETIPSGTIPGLQVPLSPGDGWVCEEGDFVMVHAAY
TTHLSSDVFFAPASRLDDGLIYLVIIRSGVSRHQLANFMLSLNTGTHLPVGEDPFVKVVA
CRAFRIEPTGSDGILVVDGEKVDYGPIQAEVMPGLINVMTTSGQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacgaagccatctcggaggagaccatgctgaggaagcagagcattactccc
ccagagacctccactccctccccctcaccctcaccatccacacccactcccacgaccatc
tccgcctccgactcggagctgagcgagatcttcttcgtggagaacagccggcggaagcag
agcatcaagatccaggtgaagctctgcccggagggggtctacctgcggcgggagaccgac
gaggacgaccacatcaacgagcagctcatccggatcgacgacatcatcggctccaggtac
ggtccccgcttgaagaagagggcccggggtggcctcaactcctgcaagaatcccaatgga
ccgggacaggaggcagctccggagccggacagtgacaacagtgcctacctgtacatctat
gcgtatctgaagaaggagaagccactgcggcgggtgcagacactgaggattctccgcttc
cgctccagcaacgactacggcgtgaacctgaagacggcggagacctggcatcgcaccatc
cggcagcacaagcgctccaacggcagcagttccccggccgacaccgggaaacagctcctc
atcctcctgaatcccaagtccgggtcgggcaagggacgggagctgttccagaagcaggtg
gctcccctcctcaccgaggccgaggcgcagtatgacctccagatcaccacccatccgcag
tatgcgaaggagtttgtgcggacgcggaaggatctcctcgagcgctactccggcatagtg
gtggcctcgggggatggtctcttctacgaggtgctcaacgggctgatggagcgcatggac
tggcggcgggcgtgtcgggagctgcccctcggcatcataccctgcggctcggggaatggc
ctggccaggagtgtggcccatcactgcaacgaaccgtacgaaccgaagcccatcctgaac
gccactctgacgtgcatcgccgggaagagcacgcccatggacgtggtgaggatcgaactg
gccccgggtggggacaagcactacgtcatgtactccttcctctcggtgggatggggtctg
atcgccgacattgacatcgagagcgagcggctccggtccattggagcccaaaggttcact
ttgtgggccatcaagcggctgatcaccctgcggacgtacaagggcaaggtctactaccta
agggccaccgccacaccaccgaagaagtcggagccggtggtggagatggccagggaggcg
gaggagaacccccaagccaaccgatcatcccttcccgagttccaggacctgcccgaggag
gatgagttggatgccgatcactttgctgatgccatatccctggacagatccgtctaccgg
cagcacgccgacagctggcactcggccatgtcccggcgcaccgcctactactccctgggc
ggtcccagtctccggtccaatcgcagccggatgagcatcacccagcggatcgaggctgcc
aatgcggagttcgccgaaacgattccctccggcaccatacccggcctccaggtgccactc
tcccccggcgacgggtgggtctgcgaggagggcgacttcgtgatggtccatgccgcctac
accacccacctgtcgtcggacgtgttcttcgccccggcctcccgcctggacgacggcctc
atctacctggtgatcatccggagcggcgtcagtcgccaccaactggccaacttcatgctc
agcctcaacaccggcacccacctgccggttggagaggatcccttcgtcaaggtggtggcc
tgccgggccttcaggatcgaaccgactggctccgatggcattctggtggtggacggggag
aaggtggactatggacccattcaggcggaggtgatgccgggtctgatcaatgtgatgacc
accagtgggcagtag

DBGET integrated database retrieval system