KEGG   Drosophila ananassae: Dana_GF22859Help
Entry
Dana_GF22859      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dan  Drosophila ananassae
Brite
Chromosome and associated proteins [BR:dan03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dana_GF22859
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dana_GF22859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6505511
NCBI-ProteinID: XP_001967817
FlyBase: FBgn0099853
UniProt: B3MUM0
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaaccagtggaaaggcagccaagaaggctggcaaagctcagaaaaatata
accaagaatgataagaagaagaagcgcaagaggaaggaaagctatgctatttacatctac
aaggttctgaagcaggttcaccctgacactggaatttcgtctaaagctatgagtataatg
aacagcttcgtaaacgatatctttgagcgtattgctgctgaggcttcgcgtctggctcat
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgtcttctcctg
cctggagagttggccaagcatgccgttagtgaaggaaccaaggctgtcactaagtataca
agctccaagtag

DBGET integrated database retrieval system