KEGG   Drosophila ananassae: Dana_GF22859Help
Entry
Dana_GF22859      CDS       T01059                                 

Definition
GF22859 gene product from transcript GF22859-RA
Orthology
K11252  
histone H2B
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaaccagtggaaaggcagccaagaaggctggcaaagctcagaaaaatata
accaagaatgataagaagaagaagcgcaagaggaaggaaagctatgctatttacatctac
aaggttctgaagcaggttcaccctgacactggaatttcgtctaaagctatgagtataatg
aacagcttcgtaaacgatatctttgagcgtattgctgctgaggcttcgcgtctggctcat
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgtcttctcctg
cctggagagttggccaagcatgccgttagtgaaggaaccaaggctgtcactaagtataca
agctccaagtag

DBGET integrated database retrieval system