KEGG   Drosophila ananassae: Dana_GF22987Help
Entry
Dana_GF22987      CDS       T01059                                 

Definition
GF22987 gene product from transcript GF22987-RA
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dana_GF22987
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF22987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2782 aa AA seqDB search
MTFDTRRQAGGQPGSTSTSSSSTTATTTTTSPAQSMGSVTGTGTGTGSGSGSGAGTVTTT
SIIGGGVGGGQVTSNTQEQQTPSVGNRSAEVTDVVASSSASSVDSTVTLVPPEKLISSFP
TTKLRMLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHNCEPCVEFYRNGLTTSF
AKILTDEAVNSWKYNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPENKFNTFN
AARHPVCFATPDAIWGPLDSNKMFAKPPPEPKNARGWLVDLINRFGQLGGFDNLLERFNS
GLELLKRNQNKPTAKEASDGQDNRLTLALIHSLLRPFGQCYELLTPATIAKYFMPTWNVV
LDLLDSFTDEELKREVKPEGRNDYINGIVKSARFLASRLTGQEELIRDLEMFRLKMILRL
LQVSSFNGKMNALNEINKVLSSVAYYSHRSQPLPHCMPEDEMDWLTAERMAQWIKSSDVL
GIVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKL
AWDFTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAH
SQEVPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVGELKSGDSWVLPALRLIRDI
CCLYDTTPNHAPRTQTGTNRQQVIERLQNDYTLVILVTNSLTAYMEKVRQMVAETPGLDP
ATILIDQRFPHHAQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVSAVFPADREECFR
WFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHR
GYILDNEDLIGKDYLWRVITTGGEDIAGKAIDLLKEVSTALSPRLQENVAEFHEMFIGEC
CSRLRNHYGNIMILGKTQLQDELEAPDQSDNANDESKDAKMRFIEAEKMCRILKVLQEYV
KECDRSYSGDRVHLPLSRVTRGKNTILYIRFQTPGRPIDDLEIVTHSNETMAAFKRSLLK
RIKGTSTANIKVDLFYTNGEMIEVSDEINPLYQYTIRDKMVLTAKLTPVGTGLASSPDSS
SDSSTGSPPRPCPDMQRIESESTLPGVIISQNYQYTEFFLKLYQLGSDLEHGRLRDSAKV
LLHLLPCDRQTTRQLQLMCRVPKAAIAAVAVGEKAAKEDEEKQNSSDQSSSDPEEEHCTP
EQMFLHPTPAQVLYNLSVLHGLLIPALDPLGEAALQVQSAWMHSGCAHFVLELLTKNNFL
PSADMHTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPMICDLDNGARSQVDILKQNFSTM
PNSSQGTLRAISAKLAVMLAREMLSATPEGERCRTLFSSTLQWSCPDISTIKAVVQLAWA
SSCGNLQALGSSSNAGGDFEDEVIVPDGQDFSMCKEALEVLTISFILNPSANEALSSDAN
WPKFITSIVLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNLLVGALKTLVPQYEAT
CAEFFSMLCRTLSYGCIYNWPLQIGEGLLGDEIKWLQRIRENVRATGDTQVHEELLEGHL
CLAKELMFFLVPDSKAQLNELIHELIDDFLFTASREFLHLRRHGSLRQDTVPPPVCRSPH
TIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPTKGFCGLKN
AGATCYMNSVLQQLYMVPAVRVGILRAHGAATNDGEDFSGDSDLTGGGLGPALFSGPSAA
LVSFSSSSSSSSGAGEDGAQDVRKNYHVVILKHVQAIFAHLGHSALQFYVPRGLWTHFKL
QGEPVNLREQQDAVEFFMSLFESLDEGLKALGHPQLMNATLGGSFSDQKICQECPHRYSK
EEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRLCVKKLPPVL
AIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETT
KYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAQCFG
GDYMGEIYDNNLKRMQYRRQKRWWNAYMLFYTRCDQNPVQFEPSVEQLSLTESRNMVLPL
PKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNIPSVRSDKITPAAEELSLLGVQL
ASQFLFHTGFRTKKSLRGPVIDWYDTLSHHIRSSALVRKWFANHALLSPPSRLGEYILMA
PSPEVRTVFVKLVVFFCHFAIHDEPLPGFDGANLCEQVLISVLRLLKSEAADYGKHLPHY
FSLFSMYVGLGTREKQQLLKLNVPLQFIQVALDDGPGPAIKYQYPEFSKLHQVVSHLVRC
SDVSEKCQSSNQNARPLPNPFKDATVSQEELTPLSTECMDLLFNRTGYIKKVIEDTNVGD
EGLKLLQYCSWENPHFSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIEDSWQHHRIHN
ALNGVAEEREGLLDTIQRAKTHYQKRAYQIIKCLTQLFHKSEIALQMLNTNATISRHWSV
AVEWLQDELERQRGIGCQYNSYSWSPPAQSNDNTNGYMLERSQSARNTWTMAYELCPDEI
TEKPDQDENNESDLESNLDENKADPAAQTAETQEGLTGGTELVGDAKPATTSSPSTGAWL
ARGDNNAIPRLSRQLFGVYTATTPATTTTPAATAGSGANSETESSAQETTTGETTLNGLT
NRLDHMEIKAKKGVRSRSKGGKLPPVLFHQHQLPPEQQLKLKQQQLQAHQHQLSLQLQPK
QPHEQQQQQRGDTSKSSSSRLI
NT seq 8349 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacacgcgcaggcaagccggcggccagccgggcagcacatcgaccagcagc
agcagcacgacagcgactaccaccacgaccagtccggcgcagagcatgggatcagtcacg
gggacaggcactggcactggcagtggcagtggcagtggcgctggcacagtcaccaccaca
tcgatcatcggaggtggcgttggcgggggccaagtgacgagcaacacccaggagcaacag
acgccatcggtgggcaacagaagtgccgaagtcaccgacgtggtggcctcgtcttcggcg
agtagcgtagacagcaccgtgacactagtgcctccagagaagctgatatcctcgtttccc
acgaccaagctacgcatgctgacccagaagatttccaatccgcgctgggtggtgcctgtg
ctgccggagcaggagctggaagtgctgttgaacgcggccattgaactgactcaggctggt
gtcgaccacaactgcgagccgtgcgtggagttctaccgcaacgggctgacaacatctttc
gccaaaatcctcaccgacgaggcggtgaactcgtggaagtacaacatccatcattgcatc
ctggtgtcctgcggcaagctacttcacttgatagccattcacatgcaacgcgataatccc
tacctgctggatcttctggcgatagtcttcgatccggagaacaagttcaacaccttcaat
gcagcccgccatccggtgtgcttcgccactccagacgctatctggggcccgctggacagc
aacaaaatgttcgccaaaccgccgccagaaccgaagaatgcgcgtgggtggctggtagat
ctcattaatcgtttcggccaactcggcggcttcgacaatcttctggaacggttcaacagt
gggctggagctgctgaagcgaaatcagaacaagcccactgccaaggaagctagcgatggc
caggacaaccgtctaacgctcgccctcatccacagtctgctgcggccatttggccagtgc
tatgagctgctgactcccgccaccatcgccaagtacttcatgccgacctggaatgttgtg
ctggacctgctggacagcttcacagacgaggaattgaagcgcgaagtgaagcctgagggc
cggaacgactacattaatggaatcgtgaaatcggcacgctttctggccagccgcttgacc
ggccaggaagagctgatccgcgatctggagatgtttcggctgaagatgatcctgcggcta
cttcaggtgtctagctttaatggcaaaatgaacgctctcaacgagattaacaaggtgctc
tcctctgtggcctactactcgcaccgctcgcagccgctcccccattgcatgccggaggac
gagatggactggctgacggctgagcgaatggcgcagtggataaagtcctcggacgtgctg
ggcattgtgcttaaggactcgttgcaccagccccaatacgtggaaaagctggagaagatc
atccgcttccttatcaaggagcaggctcttacgctcgacgatctggacgcggtgtggcga
gcccaggcgggaaaacacgaagcgattgtgaagaacgtccacgatctgctggcgaagctg
gcttgggattttacccccgagcagctggaccatctcttcgaagcgttccaggccagcatg
accaccgccaacaagaggcaaagggagcggctcctggaactgattcgacgactggccgag
gacgacaagaacggagtgatggcccagaaggtgctgaaactcttctggaccttggcccat
agtcaggaggtgccgccggaggtgctggatcaagcgctgggcgcccacgtcaagattttg
gactacagctgttcgcaggagcgagacgcccagaagaccatctggctggataagtgcgtg
ggcgagctgaaatctggagacagctgggtgctgccggccttgcgtcttatccgggacatt
tgctgcctgtacgacaccactccgaatcatgctccgcgcacgcagacgggaacgaatcgg
cagcaagtgatcgagcgtttgcaaaacgattacacactggttattctcgtgacgaacagt
ctgacagcgtacatggaaaaggtgcgtcaaatggtggccgagacgcccggactggatcca
gctaccattttgatcgatcagcgatttccgcaccatgcccagatcgccgagagactggag
ttcctcaagtttctcctaaaggacgggcagttgtggctgtgcgccgatcaagccaaacag
atctggcactgcctggcggtgagtgccgtctttccggcggatcgtgaggagtgcttccgc
tggttcggcaagctgatgggcgaggaacccgacctggatcccggcatcaacaaggacttc
ttcgagaacaacatccttcagctggatccgcacctgctcaccgagagcggaatcaagtgc
tttgagcgcttcttcaaggcggtgaactccaaggaggacaagctgaaagcgatacacaga
ggttatattctggacaacgaagatctcattggcaaggactacctgtggcgggtgattacg
acgggaggcgaggacatagccggtaaggcgatcgatctgttgaaggaggtgtcgacggcg
ttgagtcccaggctgcaagagaacgttgccgagttccatgagatgttcatcggcgagtgt
tgttcccgcctgcgcaaccattatggaaatataatgatcctgggcaagactcagctgcag
gacgagctcgaggcgcccgatcagtcggacaacgccaatgacgagtcgaaggacgccaag
atgcgcttcatcgaggcggagaagatgtgtcgcatactcaaggtgctgcaggagtacgtg
aaggagtgcgaccgctcctatagtggcgaccgcgtccacctgcccctcagtcgggttacg
cggggcaagaacactattctgtacatacgcttccagactccggggcggcccatcgacgac
ctggagattgtgacgcacagcaacgaaacgatggccgcgttcaagaggagcctcctcaaa
cggatcaagggcacctccacggccaacatcaaggttgatctcttctacacgaacggcgag
atgatcgaggtctctgacgagattaatccgttgtaccagtacactatccgggacaagatg
gttctcacggccaagctaacgccagtgggcaccggcttggccagcagccccgactcctcg
agtgactccagcaccggttcaccgcctcgcccctgccccgacatgcagcgcattgagtct
gagagcaccttgcccggggtaatcatatcgcagaactaccagtacaccgagttcttcctg
aagctctatcagctgggcagcgacctggagcacggccgtctgagggacagcgccaaagtg
ctgctccacttgctgccctgcgatcgccagacgacgcgacagcttcagctcatgtgccgg
gtgcccaaggcggccattgctgctgtggctgtgggagagaaggctgccaaggaggacgag
gagaagcagaattcaagtgaccagtcatcgagcgatcccgaggaggaacactgcacgccg
gaacagatgttcctccacccgacaccagcccaggttctgtacaacttgagcgttctgcac
gggctgctgattcctgccctggaccctctgggcgaggcagccctgcaggttcaatccgct
tggatgcactcgggctgcgcccactttgtactggaactgctgacaaagaataatttcctg
cccagcgctgacatgcacacgaaacgggcgtcgttccagtgtgtgctgcgcttggcgaag
ctgttcctgtacatcgtgggcagtgtgttgtcccgtgttggggacgagcccatgatctgc
gacctggacaatggagcccgttcccaagtggacatcctgaagcagaacttctcgacgatg
ccaaacagctcgcaaggcaccttgcgggccatctccgccaagttggcggtgatgctggca
cgcgagatgctgtcggccactccggagggtgagcgctgccgcacactgttcagctccaca
ttgcagtggtcgtgtccggacatctccaccatcaaggcggtggtgcagctggcgtgggcc
tcgtcctgcgggaatctccaggccctgggcagcagcagcaacgctggcggagactttgag
gacgaggtgatcgtgcccgatggccaggactttagcatgtgcaaagaggcgttggaagtg
ctaaccatttcgttcatactaaatccgagtgccaacgaggccctaagcagcgacgccaac
tggccgaagttcatcacatcgatcgtgctcaagaatccgttgcggcatgtgcggcaggtg
gcctcggagcagctgtttctggcctccacctactgtgccggcgaccggcggccattcgtc
tacatggtcaacttgttggtgggagctctgaaaaccctggttccccaatacgaggccact
tgtgcagagttcttctccatgctctgtcgcacactgtcctatggttgcatctacaactgg
ccgctgcagatcggcgagggacttttgggcgatgagatcaagtggctgcaacgcatccgg
gagaacgttcgggctaccggtgacacccaggtgcacgaggagctgctggaggggcatttg
tgcctggccaaggagcttatgttcttcctcgtcccggactcgaaggcacagctcaatgag
ctcatccacgagctcatcgatgacttcctgtttacggcctcgcgcgaattcctgcattta
cggcggcacggcagccttcggcaggacacagtgccgcctcccgtttgccgcagtccgcac
acgattgccgccgcctgcgaccttctaattgccttgtgccagctctgtgttcctaatatg
aagctactcaccaatacactaatcgactttgtttgcacggacacggatccgttgcgcgag
tgggattatctgccgccggttggcgccaggcccacaaagggtttctgcggacttaaaaat
gccggggccacctgctacatgaattcggttctgcagcagctatatatggtgccggcggtg
cgggtgggcattctgcgggcccacggtgctgccaccaacgatggcgaggacttcagcggc
gattctgatttgacgggcggcggtctgggaccagctctcttctcgggtccctccgctgcc
ctagtctccttctcctcgtcgtcgtcgtcatcgtcgggcgctggcgaggatggggcccag
gatgtccggaaaaactaccacgtggttattctgaagcacgttcaggccatatttgcccac
ctgggtcacagcgctctgcagttctatgtgccccgcggactatggacgcatttcaaactg
caaggagaacctgtgaatctgcgggagcagcaggatgctgtggagttcttcatgtccctg
ttcgagagcctcgacgagggactgaaggcactcggccatccgcagctgatgaacgccacg
ctgggcggctctttcagtgaccagaagatctgccaagagtgcccccatcgctactccaaa
gaggaaccatttagtgtatttagtgtcgatattaggaatcatagctcattaaccgaatct
ctagagcagtacgtcaaaggggagctgctcgagggagcggatgcataccattgtgataaa
tgtgataaaaaagtagttaccgttaagcggctatgcgtgaagaagctgccacccgtgtta
gccatacaactgaagcgcttcgaatacgactacgagcgcgtctgtgcgattaaatttaat
gattattttgaatttccgcgtattctggatatggagccctacacagtgtctggcctagct
aagctagagggcgaagtggtggaggtgggtgataattgtcaaacaaacgttgaaacaaca
aagtacgaactgaccggcattgtggtgcacagtggacaggcctccgggggccactacttc
agctacatactatccaaaaacccagcgaatggtaagtgccagtggtacaagtttgacgat
ggcgaggtaaccgagtgcaaaatgcacgaggacgaggaaatgaaggcacagtgcttcggt
ggcgactacatgggcgaaatttacgataacaatctgaaacggatgcagtaccgccgccag
aagcgttggtggaacgcctacatgctgttctatacgcgctgcgaccagaatcccgtacag
ttcgagccaagtgtggagcaactgtcgctaacggaaagccgaaacatggtcctgcccctg
cctaagcccatcgagcgtagcgtacgccatcaaaatataaggtttctgcattcacgtagc
atcttctccgtggagttcttcaacttcataaagaagctggtcagctgcaatatcccatct
gtccggagcgataagatcacacccgccgccgaggagctttccctgttgggcgtacaattg
gcatcacagttcctgttccacactggtttccgtacgaagaaatcactgcgcggtcccgtc
attgattggtacgatacgctttcccatcatatacgctcctcggcactggtgcggaagtgg
tttgccaaccacgccctgctgtcgcctccctctcgcctgggtgaatacatcctaatggcg
ccctcgccggaagtgcgcacggtgttcgtgaagctggtagtgttcttctgtcacttcgcc
atccacgatgagccattgcccgggttcgatggcgccaatctctgcgagcaagtgctcatc
agtgtgctgcgtctgttgaagtcagaggcagccgactacggtaaacatctgccgcactac
ttcagccttttcagcatgtatgtggggctcggaactcgcgagaagcagcagctgttaaaa
ctaaacgtcccgctgcagttcattcaagtagccctcgacgatggcccaggtccggccatc
aagtaccagtacccggagttcagcaaactccaccaagtggtttcccacttggtgcgttgc
agtgatgtgagcgagaagtgtcagagctcgaaccagaacgcccgaccccttcccaatccg
ttcaaggatgcaacggtatcgcaagaggagctcacacccctgtccaccgagtgcatggac
ctcctgttcaaccgcactggctacatcaagaaggtcattgaggacacaaacgtgggcgac
gaaggcctgaagctgctgcagtattgcagctgggagaaccctcacttctcacgggctgta
ctcacagagttgttgtggcagtgcggctttgcctactgccacgacatgcgccaccacacg
gacctgctgctgaacatcctgcttattgaggactcgtggcagcaccaccgcatccacaat
gcgctgaatggagtggccgaggagcgcgagggactgttggacacaattcagcgggccaaa
acgcactatcagaaacgggcataccagataatcaaatgcctgacgcagctgttccacaag
tccgagattgctctgcagatgctcaacaccaacgccaccatcagccggcactggagcgtt
gccgtcgagtggctgcaggacgagctggagcggcagcggggcatcggctgtcagtacaac
tcctactcttggtcgccgccggctcaaagcaacgacaacaccaatgggtacatgctggag
cggtcgcagtcggctagaaacacatggaccatggcctatgagctctgtccagatgagata
accgagaaaccggatcaggacgagaacaacgagtctgatttggagtccaatctagacgaa
aacaaagcggacccggcagcacagactgcagaaacgcaggaaggcttaactggaggcacg
gaattggtgggcgatgccaagcctgccaccaccagtagtccctcaactggcgcctggctg
gctcgaggggataataatgccatcccacggctctcgcgacagctctttggagtgtataca
gcaacaacacccgcaacgacaacgacgccagcagcaacggcgggcagtggggcaaatagc
gagactgagagcagcgctcaggagacgacaaccggagagacgacgttaaatgggctgacc
aatcgattggaccatatggaaatcaaggccaaaaagggcgtgcgaagtcggtcaaaggga
ggcaaactgccgccagtactctttcaccagcaccagctgccgccggagcagcaactcaag
ctgaagcaacaacaactgcaggctcaccagcatcagctcagcctgcaactgcagcccaag
cagccgcacgaacaacagcagcaacaacgtggtgatactagcaagagttcctcaagccgc
ttgatttga

DBGET integrated database retrieval system