KEGG   Drosophila ananassae: Dana_GF23000Help
Entry
Dana_GF23000      CDS       T01059                                 

Definition
(RefSeq) GF23000 gene product from transcript GF23000-RB
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dan  Drosophila ananassae
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF23000
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dana_GF23000
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dana_GF23000
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dana_GF23000
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dana_GF23000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 386 aa AA seqDB search
MRPIQRFVYTFGHRTCSQLPLIGGVSVSTRITRAPMAFSARQSSSSVLATESSNKGMIIL
NRPKALNAINLEMVRKIYKHLKKCEKSKSLLIIKGTGDKAFCAGGDVRALVEAGPTDESK
SFFREEYTTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVATDRTLFAMPETAIGLF
PDVGGSYFLPRLQGKLGLYLGLTGYRLKGGDVFYSGIASHYCESCKIPELETALLNCPDA
DDVPELLQKFHSKPEKPFSLEPFLEQINKNFAADSVEGILENLQNDGSEWAKKTLETLCK
MSPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLIDKDQKPQWQP
SQLSEVTEEHVQWFFRKLPDTEELKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccattcaaaggttcgtgtacacattcggtcatcgcacctgcagccaattgccg
ctaatcggcggagtctcggtatcaacaagaataacaagagccccaatggccttctcagcc
cgccaatcctcctcctccgtgctggccacggagtcgtccaacaagggtatgatcatactc
aaccgtcctaaggcgctgaatgccatcaacctggagatggtgcgaaagatatacaagcac
ctgaagaaatgcgagaagtccaaatctctgctgataatcaagggcaccggagacaaggcc
ttctgcgccggcggggacgtgcgtgccctcgtcgaggcgggacccaccgatgaatcaaag
agcttcttccgggaggagtacactaccaacgccctgattggaaactacaagataccttac
attgccatcatcgatggaattaccatgggcggtggtgtgggactgagcgttcacggcaaa
tatcgtgtggcaacggaccgcactctgttcgctatgcccgaaacggctatcggcctgttc
ccggatgtgggcggctcctacttcctgccgcgccttcagggcaaactggggctctacctg
gggcttacaggctatcggctaaagggcggcgatgtgttctattcgggcattgcctcgcat
tattgcgaaagctgcaagatcccagaactggaaaccgccctgctcaactgtccagatgcg
gacgatgtgccggagctgctgcaaaagttccactcgaagccggagaagcccttctcattg
gaaccctttttggagcaaatcaacaagaactttgcggcggattcggtggagggcattctg
gagaatttgcagaacgacggcagcgaatgggcgaagaagacccttgagactctgtgcaag
atgtcgcctacgtcaatgaaggtcacgttccgccagctggagctcggctcccagctatcc
ctggcccagtgcctgatcatggagtaccgcctggccgtgcgtcacctggagcgcagcgac
ttcaaagagggagtgcgagccctgctcatcgacaaggatcagaagccccagtggcagccg
tcccagctgtctgaggtcaccgaggagcatgtgcaatggttcttccgcaagctgcccgac
accgaggaacttaaactgtaa

DBGET integrated database retrieval system