KEGG   Drosophila ananassae: Dana_GF23156Help
Entry
Dana_GF23156      CDS       T01059                                 

Definition
GF23156 gene product from transcript GF23156-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dana_GF23156
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dana_GF23156
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dana_GF23156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 899 aa AA seqDB search
MAQLKKLHMSSNLEGLEKMTSIPDLRNRNMKMLLNTARKLYVTAEEYRLEGDEELAYITY
MKYFNMLSAIRKKSDYVNHKSTVRQMLGDTDANRRIMDSLELISNSLARRYALLGKPSTV
EPIANFVNGRTVVESTTKNVSSQPADFSRLGLISCQELYRRMQEKTVLVMDCRSSSDYEI
SHLTYYCAFNVPDELIVAGMSAGRLQARLSSSAKASWASRSVKDSVVLMDWNTKDAQPAA
NTAIATLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHCTNPSVQAPKQNNNDIETI
DDIEYPSIHDITMKEDISARDFKTRPDINRASKPAALKTYEQGQTKAVIEAKPIAEIMRD
QEEFLQRAEQNDAQLENAFELWKRQTAEGDAADNQELHYRILQLESRQQDFILENNRLRD
EVTRYKEQLKTDTPQKISSKDVEATRNVESKIQERQRLDEQHELERLERERQLAIAREAK
KHYKSPPPPSPLPVKRPLDGVHDLSESLDSLLKLPEEELDPIPLDRIERPTFDRATKPQQ
NKAVSSPARVRDFSPVKGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYK
SYISRSNRTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFL
TILMDWLHSDLQTLHVARQRETISASEKAWLEFTKAKESMILHLFYGQIKSTVKCVACNK
ESATYECFSNLSLELPPNSNVCQLNQCMDMYFSGERIQGWNCPNCNTKRDAIKKLDISKL
PPVLVVHLKRFYADPGNTGAYIKKQNYLRFPLDNLEMTPYIARAESRAVTPKTYQLYAVS
NHYGTMEGGHYTAFCKSANYGRWFKFDDQIVSALDTSNVVSSAAYILFYTWLPPMQMSL
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggcccagttgaagaagttgcacatgagctccaatctcgagggcctggagaagatgact
agtattcccgatctgcgcaacagaaatatgaaaatgctacttaacaccgccaggaaactg
tacgtcactgcagaggagtatcgtctagaaggcgacgaagagttggcctacatcacctat
atgaagtactttaacatgttatccgccatccgcaaaaagtcagactatgtcaaccacaag
tccactgtgcgtcaaatgctgggcgacaccgacgccaatcgtcgcattatggactctttg
gagttgataagcaactctctggcgcggcgctacgcactgctgggaaaaccttcgacggtg
gaaccaatcgccaatttcgtcaatggtcggacagtggttgaatcaaccactaaaaacgtt
tcctcccagccagcggatttttcccgcttggggctgattagctgccaggagctgtaccgg
cgcatgcaagagaaaacggttctggtcatggactgtcgttccagttccgactatgagatc
tcgcacctcacgtactactgcgcgttcaatgtgcccgatgaactaatagtggctggaatg
tcggcgggtagactccaggcgcgactcagtagcagcgccaaagcatcgtgggcttcgcga
tctgtcaaggactcggtagtgctcatggactggaacacgaaagatgcccagccggctgcc
aatacagcaattgcaacgcttctggatatcctaaaaaattgggatccagatgtgacgtac
cgcgctcccattcaaattgttgagggcggctacgagtatttcataatgatgtatcccact
cactgcaccaatcccagcgttcaggcaccgaagcagaacaacaacgacattgaaaccatt
gacgatatcgagtatccctcgattcatgacatcacaatgaaggaggacatcagtgcgcgg
gattttaagacacgaccagacatcaatcgggccagcaagccagcagcactaaagacctat
gaacagggccagacgaaagcggttatcgaggctaaaccgatcgccgagataatgcgagat
caggaggagtttcttcaacgagcagagcaaaatgatgcgcagctggaaaacgccttcgag
ctgtggaagcgccaaacggctgagggagatgctgccgataaccaagaactgcactaccgg
attctgcaattggagagccgacagcaggactttatactggaaaacaaccgtttacgtgac
gaagtcacacgctataaggaacagctaaaaacggataccccacagaagatatcgtctaaa
gatgtggaggccacccgaaacgtcgaatctaagattcaggaacgccaacggcttgacgag
cagcacgaactagagcgtttggagagggagcggcagcttgccatcgcccgcgaagccaag
aaacattataagtcaccgccgccaccaagtcctttgccagtaaagagacccttagatggc
gtacatgacctctccgaaagcctagattctctgctcaagctacccgaagaagaattggat
cctatcccattggatcgtatcgaaagacccacttttgatcgggcaacgaaaccgcaacaa
aataaagctgtgtcttcaccggcgcgggtccgtgatttctcacccgtcaagggtcagaat
gtgggtcgtggactaactggtcttaaaaatctgggaaatacttgctacatgaacagcatt
ttacagtgcctgagtaatacgccgcagctaaccgagtattgcatttcggataagtacaaa
agttacatcagcaggagcaatagaacaaatggacaagtgatcgaggaggtggccgcacta
attaaggaactgtggaacggtcaatataagtgcgtggccagccgggatttgaggtatgtg
gtgggtcagtaccagaagatcttccgtggcgttgaccaacaggattcccacgagtttctc
accatactgatggactggctgcactcggacctacaaacgctgcatgtggctcgccagagg
gaaacaatcagtgcttcggaaaaggcatggctggagtttacaaaggccaaagaaagtatg
atcctgcatttattctacggtcagattaagagcaccgtcaagtgcgtggcctgcaacaag
gaatctgccacctacgagtgcttctcgaatctcagtctagagctgccgccgaactcaaat
gtgtgtcagctgaaccagtgcatggacatgtactttagcggggagcgcatccaaggctgg
aattgtccgaactgcaacaccaagagagatgcaattaaaaagctagatatatccaagctg
cctccagtactagtagtgcacctgaagcgattttatgcggatccgggcaacacaggtgcc
tacataaaaaaacaaaactatctgcgttttccattggataatctggaaatgactccgtat
atagctcgggcggaatctcgagccgttacgccaaaaacttaccaactttacgccgtttcc
aaccactacggcaccatggagggtggacactacaccgccttctgtaagagtgcaaactac
ggcaggtggttcaaattcgacgatcagattgtttccgctttggacacctccaatgtcgtc
tccagcgcagcttatattcttttctacacctggctgccacccatgcaaatgtcgctgtga

DBGET integrated database retrieval system