KEGG   Drosophila ananassae: Dana_GF23230Help
Entry
Dana_GF23230      CDS       T01059                                 

Definition
GF23230 gene product from transcript GF23230-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dan  Drosophila ananassae
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dana_GF23230
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dana_GF23230
Translation factors [BR:dan03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dana_GF23230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 172 aa AA seqDB search
MSMEKVASKQYESKVWPEIVDSDDSDVENEIDVDKLPPLEVGPGENRLQHTYCLWFSRKG
TQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPYRELSLFKQGIKPMWEDPANS
KGGQWVIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKYPVSLNFL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaaagtagccagcaagcagtacgagtcgaaagtctggccagaaatcgtc
gacagcgacgacagcgatgtggagaacgagatagacgtggacaagctgccgccactggag
gtgggaccaggcgagaaccggctgcagcacacatattgcctttggttctccaggaagggg
acgcagcgggcggccgccgactacagcaaatcgctgcacgtggtcgggcggtgcgccagc
gtgcagcaatggtggtcgctttactcgcacctcatccggcccaccgccctcaagccctac
cgggagctgagcctcttcaagcagggcatcaagcccatgtgggaggacccagcgaacagc
aagggcggccagtgggtgatacggctccgcaagaacaagatagaacgggcatgggagaac
gtctgtatggcgatgctcggcgagcagttcctcgtcggcgacgagatttgcggcatagtg
ctccagacaaagtatccggtgagtttgaacttcttataa

DBGET integrated database retrieval system