KEGG   Drosophila ananassae: Dana_GF23292Help
Entry
Dana_GF23292      CDS       T01059                                 

Definition
GF23292 gene product from transcript GF23292-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dana_GF23292
   01230 Biosynthesis of amino acids
    Dana_GF23292
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF23292
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dana_GF23292
Enzymes [BR:dan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dana_GF23292
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dana_GF23292
  Exosomal proteins of melanoma cells
   Dana_GF23292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWFDANLSEKGKEEALAAGKAVKEAGLEFDVAHTSV
LTRAQVTLASILQASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHPYYENIVKDPRYADGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaagtacaagatcgtgatggtccgccacggcgagtccgagtggaaccagaag
aatcagttttgcggatggttcgacgccaatctcagcgagaagggcaaggaggaggctctg
gccgccggcaaagccgtcaaggaggccggtctggaattcgatgtagcccacacctcggtg
ctgacccgcgcccaggtgaccctcgccagcatcctgcaggccagcggccacaaggagatc
cccatccagaagacctggcgtctgaacgagcgccactacggtggactcactggcctgaac
aaggccgagacggccgccaagtacggtgaggcccaagtacagatctggcgccgcagcttc
gacaccccaccaccaccgatggagcccggccatccctactacgagaacatcgtcaaggat
ccgcgctacgccgacggacccaagcccgaggagttcccccagtttgagtccctcaagctg
accatcgagcgcacactgccgtactggaacgacgtgatcattccccagatgaaggagggc
aagcgcatcctgatcgccgcccacggaaacagcttgcgcggcatcgtcaagcatttagac
aatctctctgaggacgccatcatggctctgaacctgcccacgggcatcccgttcgtttac
gagctggacgagaacttcaagcccgtggtgtcgatgcagttcctcggcgacgaggagacc
gtgaagaaggccattgaggctgtcgccgcccagggcaaggccaagtaa

DBGET integrated database retrieval system