KEGG   Drosophila ananassae: Dana_GF23314Help
Entry
Dana_GF23314      CDS       T01059                                 

Definition
(RefSeq) GF23314 gene product from transcript GF23314-RB (EC:2.7.11.-)
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 358 aa AA seqDB search
MSQHHLSQVSSSFFNVKEDYNTTLDNMSREFEERWNHQTQSPHSNLENYIQRAVLGNGSF
GTVLLVKEKVGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKDFD
YLYLILPLVNGGELFSYHRRMRKFNEKQARFYACQVVLALEYMHRMHLMYRDLKPENILL
DIRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYSKSVDWWAFGILVYELVAG
RSPFAIHNRDVILMYSKICMGEYKMPSYFTQNLKNLVESLMQVETTKRLGNASDGSTDVK
NHAWFQGVDWYGILNQEVPAPYVPTVTGAEDLSNFENFELRDKMKSRINRHPELFANF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcatcatttgagccaggtttcatcgtccttcttcaatgttaaggaggactac
aacaccactcttgacaatatgagccgggagtttgaagaacgctggaatcaccaaacacaa
tcgcctcactcaaacttggagaactacatccagcgggctgttttgggaaacggcagtttt
ggcactgtgctcttggtcaaggaaaaggtgggaaagaactattatgccgccaagatgatg
agcaaggaggatctagtgcggctcaagcaggtggcccacgttcataacgagaagcatgtg
ctgaacgccgcccgattcccatttctcatctatttagtcgactcaacaaaggacttcgac
tacctctacctgatcctgccactcgtaaacggcggtgagcttttcagctatcaccgcagg
atgcgcaagttcaacgagaaacaggctagattttatgcctgccaggtagtactggctctc
gaatatatgcacaggatgcatctcatgtatcgggacctcaagccggagaatatccttttg
gacatccgcgggtatattaagataactgattttgggtttactaagcgcgtggacggtcgt
acttcaactttgtgcggcactcccgaatatttggctccggaaatcgtgcaacttcgtccg
tacagcaagtctgtggactggtgggcttttggcatcctagtctacgagctggtagctggt
cgttcgccctttgctatacacaatcgtgacgtgatcctgatgtattcgaagatatgcatg
ggcgagtataaaatgcccagttacttcacacaaaatctgaagaacctggtggaaagctta
atgcaggtggagacaacgaaacgtttaggaaatgcatccgatggctcgacggatgtgaag
aaccatgcgtggtttcaaggtgtcgattggtatggcattctcaaccaggaagttccggca
ccctatgtgcccacggtaaccggcgccgaggatctgtccaatttcgagaatttcgaatta
agggacaagatgaagtcgcgaataaatcggcatcccgagttatttgcgaatttttga

DBGET integrated database retrieval system