KEGG   Drosophila ananassae: Dana_GF23315Help
Entry
Dana_GF23315      CDS       T01059                                 

Definition
(RefSeq) GF23315 gene product from transcript GF23315-RA
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MGPQPEQPQMHFSPKVDYILILDKLRDDFNKKFATNTPSPSTGLDDYDVKATLGSGSFGK
VQLVRERETGAYYASKQLSKDQIVKTKQVAHVMSEKNVLRSMMFPNTVHLIASYKDNDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEGEYKMPSYFSGALRHLVDHLLQVDLSKRYGNLINGNRDIKEH
EWFKEVEWIPLLNQTVNAPYVPNISNPEDISNFDKVNDKARPKAKTMRHEDAFQDF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgcagcccgaacagccgcagatgcacttcagtcccaaggtggactacattctc
attctggacaagctgcgtgatgacttcaacaagaaattcgccacgaacacaccatcgccc
tcgacaggcttagatgactatgacgtgaaggccacattgggatctgggtcttttggaaag
gtgcaattggtacgggaaagggaaacgggtgcctactacgcctccaagcagctcagcaag
gatcagatcgtgaagaccaagcaagtggctcatgtgatgagcgagaagaatgtcctgcgc
tcaatgatgttccccaatacggtgcatcttatagcctcctacaaggacaacgatagtctg
tacctcgtcctgccgctaattggtggaggggagcttttcacttaccaccgaaaagttcgt
aagttcactgaaaaacaggctcggttttatgctgcccaagtatttttggctctggaatat
cttcaccattgcagtcttctatatcgcgatcttaagcctgaaaacataatgatggacaaa
aacggatatctgaaagtcaccgatttcggttttgcaaagaaagtggaaactagaaccatg
acgctttgtggaacgccggagtacttgccaccggagatcatacaatcgaaaccctatgga
accagcgtcgattggtgggcatttggagtcctggtctttgagtttgtggcaggacactcg
cctttctctgcccataaccgtgatgtgatgagcatgtacaataaaatctgtgaaggagaa
tacaaaatgcccagctacttcagtggtgcactgcgacatttggtggatcatctgctgcaa
gtggatctctcaaaacgctatggaaacctcattaatggaaatcgggacatcaaggagcat
gagtggttcaaggaagtggagtggataccgctgctcaatcaaacggtcaatgctccttat
gtgccaaatatcagcaatcccgaggatatatccaattttgacaaggtcaacgataaagcg
cggcccaaagccaaaacaatgcgacacgaagatgcctttcaagacttttga

DBGET integrated database retrieval system