KEGG   Drosophila ananassae: Dana_GF23335Help
Entry
Dana_GF23335      CDS       T01059                                 

Definition
GF23335 gene product from transcript GF23335-RA
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dana_GF23335
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dana_GF23335
Peptidases [BR:dan01002]
 Metallo Peptidases
  Family M67
   Dana_GF23335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MSKSVNNMSMGVVEPQERLKHLTHCGALIEVDKNMPVTRYYRSGTEMLRMAKVYQREGNH
ENAFILYLRYMTLFIEKIRQHPDYASVKSEVRDINKKIKDEIMPTTEKLRTKLQAHYQRE
YEQFLASKEAERVRELERERERQRQREQAGASSIPSLIPANLHVLIDEVNQPSAPDLDLL
DKVVYPNDFPTGANRSLPGSGSGLLLPAASEATAADKTAVSKPSFDRNQKPAYNRTDSLL
AGSLRLVHVPGNTMDVFLQLAHANTSKNIETCGVLAGNLSQNQLYITHIIIPQQQGTPDS
CNTMHEEQIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEALAIVCAPK
YNTTGFFILTPHYGLDFIAQCRQSGFHPHPNDPPLFMEAQHIRMDGQDKIKVIDLRS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagtcggtaaacaacatgagcatgggtgtcgtggagccgcaggagaggctgaag
cacctgacgcactgcggagccctcatcgaggtggacaagaatatgcctgtgacgcgctac
taccgctcgggcactgagatgctgcgcatggcgaaagtctaccaacgggagggcaaccat
gaaaacgccttcatcctctacctccgctacatgaccctcttcatcgaaaagattcgccag
cacccagactatgcctctgtcaagtctgaggtgcgcgacatcaacaaaaagatcaaggac
gaaattatgcccacgacggagaagctgcgcaccaagctgcaggcacactatcaacgggaa
tacgaacagttcctagcgagcaaggaagcagaacgtgtccgggaactggaacgggaacgg
gagcgacagcgacaaagggagcaggctggtgctagtagtataccttcgctgattccagcc
aaccttcatgtgctcattgacgaggtcaaccagccctcagccccggatcttgacctgctc
gataaggtagtctatcctaacgactttccaacgggcgccaatcgcagcttgccaggatcg
ggttccggtctcctattaccagctgccagcgaagcaaccgccgccgataagacagcagtt
tccaagcccagcttcgaccgtaatcagaagccggcttataaccgcacggattccctgctg
gcgggctccctgcgcctcgtccatgtgccggggaatacgatggatgtgttcttgcagctg
gcgcacgccaacacctcgaaaaacatcgagacgtgcggagttctggccggtaatctgtcg
cagaaccagctgtacatcacacacattatcatcccgcagcagcagggcactccggacagc
tgcaacacgatgcacgaagagcagatctttgatgtccaggaccagatgcagctgattaca
ctgggctggatacatactcatcccagccagactgcgtttctgtcctccgttgacttgcat
acgcactgttcctaccagatgatgatgcccgaggctttggccattgtttgtgcgcccaag
tacaacactactggtttctttatactcacgccgcattacgggctagattttattgcccag
tgccggcagtctggctttcatccgcatccgaatgacccgccactgttcatggaggcgcag
cacatccggatggacggccaggacaagataaaggtcattgatttgcgcagctag

DBGET integrated database retrieval system