KEGG   Drosophila ananassae: Dana_GF23744Help
Entry
Dana_GF23744      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dan  Drosophila ananassae
Pathway
dan00040  Pentose and glucuronate interconversions
dan00052  Galactose metabolism
dan00500  Starch and sucrose metabolism
dan00520  Amino sugar and nucleotide sugar metabolism
dan01100  Metabolic pathways
Module
dan_M00361  Nucleotide sugar biosynthesis, eukaryotes
dan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF23744
   00052 Galactose metabolism
    Dana_GF23744
   00500 Starch and sucrose metabolism
    Dana_GF23744
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF23744
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dana_GF23744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6506383
NCBI-ProteinID: XP_001957980
FlyBase: FBgn0100738
UniProt: B3M6D7
Position
Unknown
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGVRGHQRVPSDSKEFHEVTKRDALRLLENDVDRLLKTTEPARQPA
LKAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKRFIDEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLN
MEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacatccggcataagacccattgatgtgttgcttcagcgtgccggcgtgcgcggccac
cagagagtcccatccgactcgaaggagttccacgaggtgaccaagcgggatgccctgcgt
ctgctggagaacgatgtggacaggctgctgaagaccacggagccggcgcgccagccagct
ctcaaggcggagatgggacggtttgcggacctcttcggtcgcttccttcaggaggagggt
cctgccctggactggaacaaaatccagaagctgcccgagaacgccgtgatgaactactcg
aacctgaagtcgcccaaaaacgagcagaatgagatccgcaacatgttggacaagttggtg
gtcatcaagctgaacggtggtctgggcacttcgatgggttgccatggtcccaagagtgtg
attcccgtgcgttcggatttgactttcctcgatctcacggtgcagcaaatcgagcatctg
aacaagacctacgatgccaatgtcccactggtcctgatgaactccttcaacaccgatgag
gacacagagaagattgtccgcaagtacaagggcttccgagtgcagatccacaccttcaac
cagagctgcttcccgcgcatcagtcgcgaacatttcctgccagtggccaaggactttgat
gtggagaaggacatggaggcttggtatcctcctggtcacggtgacttctacgacaccttc
cgcaactctggcttgctgaagaggttcattgacgagggccgtgagtactgcttcttgtcc
aacatcgataacctcggcgccaccgttgacctgaacatcctcaacaagctggtgggcgag
gagcgagccaccaccccagtggagttcgttatggaggtcaccgacaagacccgtgctgac
gttaagggtggtactctcatccaaatggagaacaaactgcgcctgctggaaatcgctcag
gtccctaaggagcacgtggatgacttcaagtccgtgaagaccttcaagttcttcaacacc
aacaacatttgggctaacctgtctgccattgatcgtgtcttgcgcgagcgcaccttgaac
atggagatcatcgtgaacaacaagactctggagaacggaacccgtgtcatccagttggag
acggctgtgggtgctgccatgaagtgtttcgatggcgccatcggcatcaatgtgcctcgt
tctcgtttcttgcccgtgaagaaatcctccgatttgctgctggtcatgtcaaatctctat
accctgaagaacggcagcctggtgatgtcgccgcagcgcatgttccccaccactccgctg
gtcaagctaggcgagaaccacttctccaaggttaaggagttcttgggccgatttgccaac
atcccagacattattgagctggatcacttgaccgtgagcggtgatgtgacttttggacgt
ggcgtttctctccgcggcactgtgatcatcattgccaaccatggtgatcgtatcgatatc
cccgccggcgccattttggagaacaagatcgtctccggaaacatgcgtatcttggaccat
taa

DBGET integrated database retrieval system