KEGG   Drosophila ananassae: Dana_GF23744Help
Entry
Dana_GF23744      CDS       T01059                                 

Definition
(RefSeq) GF23744 gene product from transcript GF23744-RD (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dan  Drosophila ananassae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dana_GF23744
   00052 Galactose metabolism
    Dana_GF23744
   00500 Starch and sucrose metabolism
    Dana_GF23744
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF23744
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dana_GF23744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGVRGHQRVPSDSKEFHEVTKRDALRLLENDVDRLLKTTEPARQPA
LKAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKRFIDEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWANLSAIDRVLRERTLN
MEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacatccggcataagacccattgatgtgttgcttcagcgtgccggcgtgcgcggccac
cagagagtcccatccgactcgaaggagttccacgaggtgaccaagcgggatgccctgcgt
ctgctggagaacgatgtggacaggctgctgaagaccacggagccggcgcgccagccagct
ctcaaggcggagatgggacggtttgcggacctcttcggtcgcttccttcaggaggagggt
cctgccctggactggaacaaaatccagaagctgcccgagaacgccgtgatgaactactcg
aacctgaagtcgcccaaaaacgagcagaatgagatccgcaacatgttggacaagttggtg
gtcatcaagctgaacggtggtctgggcacttcgatgggttgccatggtcccaagagtgtg
attcccgtgcgttcggatttgactttcctcgatctcacggtgcagcaaatcgagcatctg
aacaagacctacgatgccaatgtcccactggtcctgatgaactccttcaacaccgatgag
gacacagagaagattgtccgcaagtacaagggcttccgagtgcagatccacaccttcaac
cagagctgcttcccgcgcatcagtcgcgaacatttcctgccagtggccaaggactttgat
gtggagaaggacatggaggcttggtatcctcctggtcacggtgacttctacgacaccttc
cgcaactctggcttgctgaagaggttcattgacgagggccgtgagtactgcttcttgtcc
aacatcgataacctcggcgccaccgttgacctgaacatcctcaacaagctggtgggcgag
gagcgagccaccaccccagtggagttcgttatggaggtcaccgacaagacccgtgctgac
gttaagggtggtactctcatccaaatggagaacaaactgcgcctgctggaaatcgctcag
gtccctaaggagcacgtggatgacttcaagtccgtgaagaccttcaagttcttcaacacc
aacaacatttgggctaacctgtctgccattgatcgtgtcttgcgcgagcgcaccttgaac
atggagatcatcgtgaacaacaagactctggagaacggaacccgtgtcatccagttggag
acggctgtgggtgctgccatgaagtgtttcgatggcgccatcggcatcaatgtgcctcgt
tctcgtttcttgcccgtgaagaaatcctccgatttgctgctggtcatgtcaaatctctat
accctgaagaacggcagcctggtgatgtcgccgcagcgcatgttccccaccactccgctg
gtcaagctaggcgagaaccacttctccaaggttaaggagttcttgggccgatttgccaac
atcccagacattattgagctggatcacttgaccgtgagcggtgatgtgacttttggacgt
ggcgtttctctccgcggcactgtgatcatcattgccaaccatggtgatcgtatcgatatc
cccgccggcgccattttggagaacaagatcgtctccggaaacatgcgtatcttggaccat
taa

DBGET integrated database retrieval system