KEGG   Drosophila ananassae: Dana_GF23805Help
Entry
Dana_GF23805      CDS       T01059                                 

Definition
GF23805 gene product from transcript GF23805-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dan  Drosophila ananassae
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dan04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dan04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MAAISGPQRHPLSNQHHFSHIDSSTAITSSAVAVAVITATSRTTAAAVAATATTINSNNS
TTSTASIASTIPPEIRQLHHLSSIGKQKPEKRGGAAGGAPQGASAILAAAAPYYQPPAVP
QDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHE
NVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYL
HSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGA
RHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTH
MLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYH
SCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRV
PLCINPQSAAFKSFASSTVAHPSELPPSPHQWE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatcagtggcccccagcggcatccattgagcaatcaacaccatttctcccac
atcgactcaagcactgccatcacctcctccgccgtcgccgtcgccgtcatcaccgccacc
tctagaaccacagcagcagcagtagcagccacagcaaccaccatcaatagcaacaatagc
accacttccactgcatccatagcatccaccattccgccagaaatccgccagctacaccat
ctgagctccatcgggaaacaaaagccagagaagcggggtggtgctgctggtggtgcgccc
cagggcgccagcgcaatcttggccgcagcggctccctactatcagccgccggcggtgccg
caggacgtccaaccggatcgtcccatcggctatggagcattcggagttgtctgggccgtc
acagatccccgggatggacgacgagtggccctcaagaagctgccaaatgtattccaatcg
ctggtctcatcgaagcgcgttttccgtgaactcaaaatgctatgcttcttcaagcacgag
aacgttctttcggccttggatattctacagccgccgcatttggatttcttccaagaaatc
tatgtgataacggagctcctgcaatcggatctgcacaagataatagtgtcgccgcagcac
ctgtccgccgaccacatcaaggtgttcctctatcagatcctgcgcggtctcaagtatcta
cactcggcccgcatcctgcatcgcgacatcaagcccggcaatctgctcgtcaactccaac
tgtgtcctcaagatctgcgattttggtctggcccgtgtcgaggagcccgaccaggccaag
cacatgacccaggaggtggtcacccagtactatcgggcaccggagattctaatgggcgcc
cgccattactcctcggcggtggatgtgtggtcggtggggtgtatttttggcgagctactc
ggacggcgtattctcttccaggcacagaatccggtccagcagctggagctcatcacagag
ctgctgggcacgcccaccatggaggatatgcgtcatgcctgcgagggtgctcgcacccac
atgctgcgccgtgcccccaagccgccttccttctcggtgctctacaccctcagctcccat
gccacacacgaagcggtgcacttgctctgccagatgctggtctttgatccggacaagcgc
atttctgtgacggatgccttggcgcatccgtatctggacgagggtcgcctgcgttaccat
tcctgtatgtgcaagtgctgctttacgacctcggctggaatgcggcagtacacggccgac
tttgagccctccgccggccagcccttcgatgatctatgggagcgtaagctgacatccgtg
cagcaggtcaaggaggagatgcacaagttcatagccgagcagctgcaaacgggtcgagtg
ccgctctgcatcaatccgcagagtgcggccttcaagagcttcgccagttcgactgtggca
catccctcggagctgccaccgtcgcctcatcaatgggaatga

DBGET integrated database retrieval system