KEGG   Drosophila ananassae: Dana_GF23866Help
Entry
Dana_GF23866      CDS       T01059                                 

Definition
GF23866 gene product from transcript GF23866-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dan  Drosophila ananassae
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dana_GF23866
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dana_GF23866
Ubiquitin system [BR:dan04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dana_GF23866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 908 aa AA seqDB search
MMIQEPVQAAIWHCMNYYDLKDAVFLAERLCSEVESDDTIFLLGTSYFRSNQVHQAYWLL
KEKARKSPQCRFLQAKCAYELKKFAEAETALIATGFADSKNFEELQKDFGELACFAYQLM
AQICVRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAASIFQIQSTDVFNTCQG
TSANSMVLFGAEQHLQQQQVNQSLVNNLSNISNYILTTPVDQQQQQQQSQQLIQNQNQNQ
NHNSNLMTPINNNNNNNNLNSSISMLRGGSLMQNSSMLAMLEDTPMGGYTHDSSVQQHQQ
LYDMSSGTPFRKQFKYLSAISPPTPSFGVMPLTSPCTGGDGSFIGAHTPVMNISSYSPMP
QMLVEVNQEPKIMGKKLKTHVGGLINRKESSLNKPAVFAQAGNITPRTPNNNNVGNNGNI
NVAPNANAAVRRSSRLFSNSAYSVKENNKSPNITNNKFVQPRSPPRKTKSRMTKICLNNE
LIEEKSHHLSEKRKEKVETITSSGANNNGNGRTAAEEAKVLLNNSLNNAQTMAHQLLGLK
KQSADGLMALLRDLAEAYQLLSNFQCKAAVKQLETTIPKHHLNSSWVQSLIGLARYEMRE
YEDAITIFERIHKAEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQNKTNPVTWCVSG
NCFSLQKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRDPRH
YNAWFGIGTIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNT
AAALDPKNPLTRFHRGSIYFSLGKYQEALRELEELKEIVPKESVVFYLIGKIHKTLGNMD
LALMHFSWATDLDPKGANNQIKDAFDSMAHPSCCPANNTALDVDLEPTSERSDDSTQAQQ
DGSYESEY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtacaggccgccatatggcattgcatgaattactacgacctc
aaggatgctgttttcctggcggagcgcctgtgctcagaagtggagagcgatgatacgata
ttcctgctgggcaccagttactttcgctccaaccaggtgcaccaggcctattggcttctg
aaggagaaggcgcgcaagtcaccgcagtgccgattcctacaagccaaatgcgcctacgaa
cttaagaagttcgccgaggcggagactgcactgatcgcgacggggttcgcggactccaag
aacttcgaggaactccaaaaagacttcggggagctggcctgcttcgcctatcaactgatg
gcgcagatctgcgtgcgaacggagcgcaataaactggccgttagtgcgctgcgacgtgcc
ctcaaactcaacccgttcatgtggcacgccttcgctgacctgtgcctgctgggccaggac
acagacgcggcatctatattccaaattcaaagtacggatgtgttcaacacctgtcagggt
accagcgccaattcaatggttctcttcggcgccgaacagcacctacagcagcagcaggtg
aaccagtcgctcgtcaataacctaagcaatatttcaaactacatactgaccacgccggtg
gaccagcagcagcagcaacagcagtcacagcagctcatccagaatcaaaatcaaaaccag
aaccacaacagcaatctgatgacgcccatcaataacaataacaataataacaatctcaac
agctcgatcagtatgctacgcggcggcagtctgatgcagaactccagcatgctggcgatg
ctggaggacacgccgatggggggctacacccacgattcgtccgtgcagcaacaccagcag
ctatacgacatgagcagcggtacaccgtttcgaaagcaattcaaatatctatcggccatc
tcaccacccacaccgagcttcggcgttatgccactgactagtccctgcaccggtggcgat
ggctcctttattggcgcccacactccagtaatgaatatcagcagctattccccgatgccg
cagatgctcgttgaggttaaccaggagcccaagataatgggaaagaagctgaaaacgcac
gtcggtggcctaataaatcgcaaagagagcagccttaacaagcccgccgtatttgctcag
gcgggtaacatcactcctcgcactccgaacaacaataatgtgggcaataatggcaacata
aatgttgcgcccaacgccaatgctgcagtgcgtcgcagttcgcggctgtttagtaactcg
gcgtactcggtgaaggagaacaacaaatcgcccaacataaccaacaataagtttgtacag
ccacgctcgccgccacggaaaaccaagtcgcggatgactaagatctgcctcaataacgaa
ctgatcgaggagaagtcgcatcatctctccgagaagcgcaaggaaaaggtggaaaccatt
acatcgtcgggagcgaacaacaacggtaatggacgcactgccgccgaggaggccaaagtg
ctgctgaacaacagcctgaacaatgcccaaacgatggcccaccagctcttgggactaaag
aagcaatcggccgacggactgatggctctgcttcgcgacttggccgaagcctatcaactg
ttgtccaacttccagtgcaaggcggctgtgaagcagctggagacgacaataccgaaacat
catctgaactccagttgggtccagtcactgattggcctggcaaggtacgagatgcgggag
tacgaggatgcaataaccatctttgaacgcatccacaaggcggagccatgtcgcctcgac
tatatggagatctactccagctctttgtggcacttgcaacgggaggtggagctctcggct
ttggcccaggatctgatcaaccagaacaagactaacccggtgacctggtgcgtttccggt
aattgtttctccctccagaaggagcacgaaacagctatcaagttcttcaaacgagccgtg
caagtggatccggactttgtgtacagctacactctcttgggccatgagctggtactgacc
gaggaattcgacaaggcgatggactactttagagcggcggtcgtccgcgatccacgccac
tacaacgcctggttcggtattggcaccatctactcgaagcaggagaagtacgaactggcc
gagattcactacgtgaaagcactgaagattaatccacagaactctgtgatcctagtccac
ataggcgccatgcagttctacatgaagaagaaggacctatccctgcagacactcaataca
gccgctgccttggaccccaagaatccgttgacccgttttcatcggggttcgatatacttc
tcgcttggtaagtatcaggaggcgctgcgggagctggaggagcttaaggagatcgtgccc
aaggagtcggtggtgttttatcttattggcaagatacacaagacactgggcaacatggac
ctggccctgatgcactttagctgggccaccgatctcgatcccaagggtgccaacaaccaa
atcaaagatgccttcgactccatggcccatcccagctgttgtccggcgaacaacacagcg
ctggacgttgatctggagcccacctctgagcgatcggacgattctacacaggcgcagcag
gatggcagttacgaaagcgagtactag

DBGET integrated database retrieval system