KEGG   Drosophila ananassae: Dana_GF23990Help
Entry
Dana_GF23990      CDS       T01059                                 

Definition
GF23990 gene product from transcript GF23990-RA
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1554 aa AA seqDB search
MTDKESEQCTVSVFDQTPGSEQKKINVVVRAQYTVKRVIDLIATQFPYGKFELLLQPHDN
KDLVHLNALDSQLLFDVEGFERQLKNHLFLLPSGSWDGDVAKRFEVPMKKRQVVVTLRPK
EAKKDGETKAKSPVSGEKKKVKKKVVAGSGTSSPSKAKVTGDDAKASVSSESSPEKSPKA
SSKIGATPKTTPSAEVALAPEEAPQATPTSTPEASPKVPATKKSLKLTPDSPSPVKPASP
IKEIDCEPIDQLTNSGISEQLQQLPQSRNLISPVDNPLSDLCVSDVEQLSDDDLALGASA
SPTMMGPSYDFGGTNNDMDGEATIGEGDQTTSGPDDGQDPMLSNFYRRKYGGDELPSWKR
IETTAADFVASATTEAETGLAKTNGGPRGYVGLVNQAMTCYLNSLLQALYMTPEFRNALY
RWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRV
MFDALEHKFKNTKQSNLISNLYEGKMNDYVKCLECNTEKSREDTFLDIPLPVRPFGSSSA
YGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQT
MHRIKLNDRVTFPQTLNLNTFINRSGNSGDQNAQINGTVDDCSTADSGSAMEDDNLSSGV
VTTASSSQHENDLNDEDEGIDMSSSTSKSTKQGSGPYLYELFAIMIHSGSASGGHYYAYI
KDFDSNEWFCFNDQNVSTITQEDIQRSFGGPNGSYYSSAYTSSTNAYMLMYRQVDAKRNE
QAAKVADFPEHIKSLLTKLHSEDENRSTRLGRHHTVPDLALPDLYKPRVYFYNPSLKKMK
ITRVYVSQSFDINLVLMSAYDMLNVEEFAPLSRCRLVAYNSTMETIIQSLENCSDPALTE
LRASQNYSLDFLLEYRAEDQQFETYAPDGITWYVFMVDLSTMAMDGPFLVYSAAREREPS
DVLRRSIAVRLHISEQQFLLATVRGTVPKAFVAYDPHPTPEAQLQLQNLANTQFKSITYF
YLNVPNTDAASLEMLGVPSMETIETASGGDVVDAAMMNGHEGAGGYSSHNDSDWRHCKRD
VLELLSQTQPSPSHGHESNSEDSSLSDGDRTLVETENLAHRGGGDSQVSSTSHSPQLSSP
EDEAASHDAMMRVHAYCNGHGSYAAADVVDPLLLPPSTSYFFHASKIKCVDVVGSSSTSG
HQSDEEAQLRKPTQAYKLLVGTHMRMVAFKRHIEQLIQVPSAYFKLQRKHESNIPSNQNN
SLVFLTEGETLTVELGKNLQADEYKAKIHFLRLGDLDNETSRLPCVCEWVYNANTTAEQA
KQELVAKLHRMDAKYATLTVDNCRIWLKGGRSPIKILANDETLYCDMRSSVAAEFIVQEC
ESGVNPQPKDDTMTIFVRRWCPAKLEFGKFQEITLDQDTDIRYSLSQISDITMDKMSYMK
VNSNFPCTSISAVSVNESSSWYSVPCSVDKYPLNTTQTGNIYLYKDKSIPIKDLTLDERR
QLSAREKARLDRVGCVSTTRYSQRRERALKIYLDSPEKSSTVTASAPMDVHVDN
NT seq 4665 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaaggagagcgaacagtgcaccgtatcggtcttcgaccagacccccggttcc
gagcaaaagaagatcaatgtggtggtgcgcgcccagtataccgtgaagcgtgtcatcgac
ctaattgccacccagttcccatacggaaagttcgagctgcttctccagccgcacgacaac
aaggatctggtccatctgaatgccctggactcgcaactactgttcgatgtcgaaggcttt
gagcggcagttgaagaaccatctgtttctcctgccctccggcagctgggacggcgatgtg
gccaaacgattcgaggtgcccatgaagaagcgccaggtggtggtcaccctgcggcccaag
gaagcgaaaaaagatggcgagacgaaggccaagagtccagtttctggggagaaaaagaaa
gttaaaaagaaggtagtagctggttcgggtacgtcgtcgccgagcaaggcaaaggtgacg
ggtgatgacgccaaagccagcgtcagttcagaatccagcccagaaaagagtccgaaggct
agctcaaagattggcgccactccaaagacgacgccttcggcggaggtagctttagctccg
gaagaggcgcctcaagcaactcccacatcgacaccagaagctagtcccaaagtcccagcg
acaaagaaaagcttaaagctaacaccggattccccgagtccggtgaagccggcatcacct
attaaggagatcgattgcgagcccatcgaccagttgaccaacagcggcatatccgagcag
ctgcaacagcttcctcagagcagaaaccttatctccccggtggataatcccctctcggat
ctgtgcgtctcggatgtggaacaactgtctgatgatgacttggctctgggcgcctccgcc
agccccacgatgatgggccccagctacgactttggaggaacgaacaacgacatggacggg
gaggcaactattggcgagggagatcaaacgactagtggaccggacgatggccaggatcca
atgttatccaacttttatcgccggaagtatggcggcgatgagctgccatcgtggaagcgg
atcgagactacggcggcggattttgtggcatccgctaccacggaagcggagacgggattg
gccaaaaccaatggcggtcccaggggctatgtgggtctggtcaaccaggccatgacctgc
tatctgaatagcttgctgcaggccttgtacatgacgcccgagttcaggaacgctctgtac
cgctgggagttcgacaacgacaatgaagcgaagaatataccttaccagttgcagaagcta
ttcctgaacttgcagacctcgcccaaggcggcggtggagacgaccgacttgacccgcagc
ttcggctgggactcaaccgaagcctggcagcagcacgacattcaggagctgtgtcgcgta
atgttcgacgccctggagcacaagtttaagaacaccaagcaatccaatctaatctcaaac
ctctacgagggcaagatgaacgactacgtcaagtgtctggagtgcaacacggagaagtcg
cgggaggataccttcctggacatcccattgccggtccgtccatttggcagtagctcggcg
tacggcagcatcgaggaggccctgcgcgccttcgtccagcccgagacgctcgacggcaac
aaccagtatctgtgcgagaagtgcaagaagaagtgcgatgcccacaagggactgcacttc
aagtccttcccatacatcctcaccttgcacctgaagcgcttcgacttcgactaccagacc
atgcaccgcatcaagttgaacgacagggtgaccttcccgcagactctaaacctgaacacg
ttcatcaatcggagcggcaacagtggcgaccagaatgcccagatcaatggcaccgtggac
gattgcagcacggcggacagtggctcggccatggaggacgacaacctgagcagcggcgtc
gtgaccaccgcgagctccagccagcacgagaatgatttgaacgacgaggacgagggcatt
gacatgagcagcagcaccagcaagagcaccaagcagggctccgggccctacctgtacgaa
ctctttgcgataatgatccactcgggtagtgcctccggcggccactactatgcctacatc
aaggacttcgacagcaacgagtggttctgcttcaatgaccaaaatgtctccaccatcacc
caggaggacatccagcgctcatttggtggacccaacggtagctactactccagtgcctac
acctccagcaccaatgcctatatgctgatgtaccgccaagtggacgccaagaggaacgag
caggcggcaaaggtggccgactttccggagcacatcaagagtctgctgactaagctgcac
tccgaggatgagaaccgtagcacgcgtctgggcaggcaccacacagtcccggacttggct
ctgccggatttgtacaaacctcgtgtctacttctacaatccgtcactgaagaagatgaag
atcacaagggtctacgtatcgcagagtttcgacatcaatctagtgctgatgtccgcctac
gatatgctgaatgtggaggagtttgcgcccctatcccgctgtcggctggtggcctacaac
tcgaccatggagacgatcatccagtccctggagaactgctccgatccggcgcttaccgag
ctgcgtgcctcgcaaaactacagtttggacttcctgctggagtacagggcggaggaccaa
cagttcgagacctatgccccggatggaatcacgtggtatgtgtttatggtagatctatcg
accatggcgatggacggtcccttcctggtttactcagcagcgagggaacgcgaacccagc
gacgtcctgcgccgctccatcgccgtccgtttacacattagcgagcaacagttcctgctt
gccacggtgcgcggcacggtgccgaaggctttcgtcgcctacgatccccatccgacgccc
gaggcgcagctgcaactccagaatttggccaacacccagttcaaatcaattacgtacttt
tacttgaatgtcccgaacacagacgccgccagtctagaaatgcttggcgttcccagcatg
gagaccatcgagactgcaagtggaggggatgtggtagacgccgccatgatgaacggacac
gagggagccgggggctacagcagccacaacgacagcgattggcggcactgcaagcgggat
gttctcgagctactgtcacaaacgcagcccagtcccagtcatgggcatgagtccaactcc
gaggacagcagtctcagcgatggtgatcggaccctggtggaaacagagaatctggcacac
cggggaggcggcgatagccaggtcagctccaccagccactcgccgcagttgtccagcccg
gaggatgaggcggcatctcacgatgctatgatgcgggtacatgcctactgcaatggccac
ggtagctatgcggctgccgatgtcgtggatccattgttgttgccccccagcacatcgtac
ttcttccacgccagtaaaataaagtgcgtggacgtcgtgggaagtagttctacttcgggc
catcagtccgatgaggaagcccagctgaggaaacccacgcaggcctacaagctcctggtc
ggcactcacatgcgaatggtggccttcaagcgacacatcgaacagcttatccaggtgccc
agcgcatacttcaagctgcagcggaagcacgagagcaacatccccagcaatcagaacaac
tccctggtcttcctcaccgagggcgaaactttaacggtggagctcggcaagaacctccag
gcagatgagtacaaggccaaaatccacttcctgcgattgggcgatctggacaacgagacg
tcgcgcctcccatgtgtctgcgaatgggtctacaatgccaacaccaccgccgagcaggcc
aagcaggagctggtggccaagctgcatcgcatggacgccaagtacgccacgctcacagtg
gacaactgccggatctggctcaagggcgggcgcagtccaatcaaaatccttgccaacgac
gagacgctctactgcgatatgcgctccagcgtggcagcggagttcattgtgcaagagtgc
gagagcggagttaacccccagcccaaggacgacacaatgaccatattcgtgaggcgatgg
tgtccggccaagttggagtttggaaagttccaggaaataacactagaccaggacaccgac
atcagatactcattatcacagattagcgacatcaccatggacaaaatgagctatatgaag
gtgaacagcaacttcccctgcacaagcatatcggcggtgagcgtgaacgagtcctccagc
tggtactcggtgccatgcagcgtggacaagtacccactgaacacgacgcagacgggcaac
atctacttgtacaaagataagagcatacccatcaaggatctgacactggacgagcgacgg
cagttgagtgccagggaaaaggccagattggatcgagttggctgcgtttcgaccacccgg
tactcccagcgtcgggagcgcgccttaaaaatctacctggactcgccggaaaagtcgagc
accgtgaccgcctcggcgcccatggacgtccatgtcgacaattag

DBGET integrated database retrieval system