KEGG   Drosophila ananassae: Dana_GF23992Help
Entry
Dana_GF23992      CDS       T01059                                 

Definition
GF23992 gene product from transcript GF23992-RA
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1091 aa AA seqDB search
MPVSVAVCETTNVVNAALRESLGVGIGSGGASSDDKSAGEDTNSLQNHIVANAKRILMTK
IEYEEVPNYQEAVLENLKSKYIVIKPTNPTNGCNLNGNTANTFGNKNNAGKIVGANGHDN
NGRKLSDHPNQNHNHANPNGHHANPNELPKPKRVLYPRENIRIGWKQSERKWQVGSGMIN
AGNTCYLNSTLQALFHIPALANWLVSEQAHMENCNVSESGSFCIICAMAKTLQATQTTQS
AVRPFLIYTKLKQICKHMIVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTP
LGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKSDSLEEAFEGYFSREKLEDFGYK
CEGCKKKVSATKQFRLERAPITLCIQLKRFSMMGNKLTKQITFKPRIDLSKFAARSPAAS
VQPLIYRLVSMVTHLGVSQHCGHYTAIGSTEAGSYYNFDDSYVRPIAIQSVCNTNAYIMF
YELDPLQTSSPAAARANGLRLTNGHGPVPVAVPATVSSPLPSPAKFIGPQLPPGGINGYS
NGHGPKTTIQFKPQHQPSHQQNGVQQSAKSPLLSTHVKVEAAAGAAALAASAAPTANGNK
SSSNHSNHKSVNQQHYLPISSEDEDSEDEVKARPTVQLPSMPKMDDCMDSGKPKSPVKTP
VKTPLKSLVPYESASEEEEVVPLPNPNARKRSSDSSDSEHEPTTSSVQLNGHSKTNGSLS
NGSSKSTDAIDEIFKSLKGYQAKKKSADSEDDDDDEDEPNNQLTNGWHPQKQSQSQSRSG
PPSPKTPPSPAVIKSKTGIWKVTRDDGDDDEDDDDDDDEVVEEARAVRTPVKNHRNPFAS
SKTATDSPTTPGAKRQKLLNGSAIKTQQQPRAGNGYQSEATANGGTVNELLKQSHRGYSS
SVLSWNGKPAELEKEPFVLVCAKRIAGHGSLDGSGSGSNTDIIDTEIPAAAVNFPSGSCS
FSLLADARDQRQRDLADDEENEMDRGRQRKVKSGSAKISNSTPGYNPFMEFENQKRWHKN
GGGGGFPRFYQNQNFRQGFQQRNKFKFNRFGGPGSAKFQQQRALQRHLAAGGGFTRRQPT
HSAQQQQQQQS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtctcggtggccgtctgcgagacgacgaacgtcgttaacgctgcgctgcgcgag
tcgctcggcgtcggcatcggaagcggtggcgcttccagcgacgacaaatcagccggcgag
gacacaaatagccttcaaaatcacatcgtggcgaatgccaagcgcattctgatgaccaaa
atcgagtacgaggaggtgccaaactaccaggaggctgtgctggagaacctcaagtccaag
tacatcgtcatcaagccgacaaatcccacaaatggctgcaatctgaacggcaataccgcc
aacacctttgggaataaaaacaatgctggcaaaattgtgggcgcaaatggacatgacaat
aacggtcgcaaactgtcggaccatcccaatcaaaatcacaatcatgcgaatcccaatgga
caccatgccaatcccaatgagctgcccaaaccgaagagagtgctgtatccgcgcgagaat
atacgcatcggatggaagcagtcggaacggaagtggcaggtgggctctgggatgatcaac
gccggcaacacctgctacctcaattcaacactacaggcgctgtttcacatcccggccctg
gccaactggctggtctccgagcaggcgcacatggagaactgcaatgtctcggagtcgggc
agtttctgcatcatatgcgccatggcgaagacgttacaggccacccagaccacccagtcg
gctgttaggccgttcctcatctacaccaagctgaaacagatctgcaagcacatgatcgtg
ggacggcaagaagatgcccacgagttcctgcgattcctagtcgaggccatggagcgggcg
tatctcatgcgctttcgtaactacaaggagctcgatcaactggttaaggagacgacgccc
ctgggacagatcttcggcggctatctgcgcagcgaggtgcgctgtctgagctgtaaccat
gtgtccatcacgttccagcacttccaggacctgctgctcgacatccgcaagtcagactcg
ctggaggaggccttcgagggatacttctcccgcgagaagctggaagattttggttacaag
tgcgagggctgcaagaagaaggtctctgccacaaaacagtttcgtttggagcgggccccc
atcacgctgtgcatccagctgaagcgcttctccatgatgggcaacaagctgaccaagcag
ataacgttcaagccccgcatcgacttaagcaaattcgcagcccgctcgccagcggcgtct
gtccagccactcatataccgcttggtgtcgatggtgacccacctgggtgtctcccagcac
tgtggtcactacacggccatcggatcaacggaagctggaagctattacaactttgacgac
agttatgtccgaccaatagcgatacagagcgtttgcaacaccaacgcctacatcatgttc
tacgagctggaccccctgcagacatctagtccggcggcggcccgtgctaacggcctgcga
ctgaccaacggtcatggtcctgtgccggtggcagtgccggccactgtctcatcgccatta
ccctcgcccgccaagttcattggaccacagctgccgcccggcggcatcaatggctatagc
aacggtcatggccccaaaacgactatacaattcaaaccacagcaccaaccatcccatcag
caaaacggtgtccagcagtctgccaagtctccattgcttagcacacatgttaaggttgaa
gctgccgcaggagcagcagcattagcagcatcagcagctccaactgcaaatggtaacaaa
agttcctccaatcacagcaaccacaaatcagttaaccagcaacattatctgccaatttcc
tcggaggatgaggacagcgaggatgaagtgaaggcgcggcccactgtccagttgcccagt
atgccaaaaatggacgactgcatggacagcggcaagccaaagtcgccggtgaagactccg
gtcaagacgccgttgaaaagcctggtgccttatgagtcggcctccgaagaagaggaggtg
gtaccactgcccaatcccaatgcccgtaaacgttccagcgactcgagcgactcggagcac
gaaccgacaacgtcgtcggtccagttaaatggccatagtaagactaatggcagtctctcc
aacggctccagcaaatcgactgacgccatcgacgagatcttcaagagcctgaagggttac
caggccaagaagaaatccgccgatagcgaggacgacgacgacgatgaggacgagccgaac
aaccaactaaccaatggatggcatccacagaaacaatcacagtcacaaagcagatcagga
ccgccttcgcctaagacgccaccctcgccggcggtcatcaagtccaagacgggcatctgg
aaggttacccgcgacgatggtgacgacgatgaagacgatgatgacgacgacgatgaggtg
gtggaggaggcgagggcggtgcggacgcccgtcaagaatcatcgtaatccattcgccagc
agcaaaaccgccacggactcgccgacaacgccgggggccaagcgccagaagctgctgaac
gggagtgcaatcaagacccagcaacagcctagggcgggaaatggctaccagagcgaggcc
accgcgaacgggggcaccgttaacgagctactgaagcagtcgcatcggggatatagctca
tcggtgctcagctggaacggcaagcccgctgagctggagaaggagccttttgtgttggtt
tgcgcgaaacggatagctggtcacggcagtttggatggcagtggcagtggcagtaacacc
gatatcatcgatacagagatcccggcagcagcagtcaacttccccagtggcagttgcagt
ttcagcctgctggcggatgcacgggatcagcgtcagcgggacctggccgacgacgaggag
aacgaaatggatcgcggcaggcagcgcaaggtgaagtccggatcggcgaaaatcagcaat
agcacccccggctacaatccgttcatggagtttgagaaccagaagcgctggcacaaaaac
ggaggtggtggcggcttcccgcgattctaccagaatcagaactttcgccagggcttccag
cagcgcaacaagttcaagttcaatcggtttggtggtccaggcagcgccaaattccagcag
cagcgagctctgcaacgacaccttgccgccggcggcggtttcacccggcgccagccgacc
cactctgcccaacagcagcagcagcagcagtcctaa

DBGET integrated database retrieval system