KEGG   Drosophila ananassae: Dana_GF24008Help
Entry
Dana_GF24008      CDS       T01059                                 

Definition
GF24008 gene product from transcript GF24008-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dana_GF24008
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dana_GF24008
Transcription machinery [BR:dan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dana_GF24008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 812 aa AA seqDB search
MSGGPSITLKSQPIDGNNTGNAAAQQQAAAANGASGSGSSGTPNGSGTGAGTGAGASNAP
AEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQAEGCRCTGWKTPQENRHRDVES
SYCPEFNEECRNSSCRHSLRTHIAHLDNISSSNMDELLGAIIDMENLFMSMQRVEDEDTK
KVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFYKYNHLSPTELQTMT
EVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQFETSL
VFGRTLLRTVYQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKDDSPIWD
PNYRPPNSFVIQQRKRHQEVTPSVAGVSAVSLGTSKRSSVGEPLHKRPKKESLERSTTSE
SVDDLPTDVVMRAMKSVSESKTTNKSEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTK
PVDKQTELWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFPS
QGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKD
IKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHNEVQKVR
PGLTCFKEGLPSIPVESIPGLREIGWKPQVRPARSSRPLEESSDPEKLATSFASVLQSVR
QHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFLNCR
FYNSPDTEYYRCANSLERYYQTKMRELGLWDK
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggcccctccataacgctaaaaagccagccgatcgatggtaacaacaccggg
aatgctgcggcccaacaacaagctgcagcagcaaatggcgcatcgggatctggttcttct
ggcaccccaaatgggagtggaactggtgcaggaacgggggcgggagctagcaatgctcca
gccgagggcacacgccagaacagcctgcagcgaatccagcagaggaagcaaaaggtcttc
aacctacccgtgccccagaagctggccaagctatcgatgtactccgcttgccaggccgaa
ggatgccgctgcactggctggaagacgccccaggagaatcgccatcgcgacgtagagtca
tcgtactgtcccgagtttaacgaggagtgccgcaactccagttgtcgccactccttgcga
acccatatcgcccatttggataatatttccagttccaatatggatgagctgctgggtgcc
attatcgacatggagaacctgttcatgtcgatgcagcgcgttgaggacgaggacaccaag
aaggtctacttgtatctgtttcggctgctccgccagtgcgtcctaacccgccaacaggct
gtaattcgaggacctctgggggatccgccattcgagtcgccctgtatcaccaaggcggtg
ctctcgctggtcttctacaagtacaaccacctcagtccgacggagctgcaaaccatgacc
gaggtggccaagacttttctcaacttcctgaatcactacaactttgagtcgccttcaacc
cgcaggggcgacctgacccacgaggacgcctccaactacaagatcaactacacccgctgg
ctggtattctgccacgttcctgccttctgcaactctctgcgtcagttcgaaacgtccctg
gtgttcggacgaaccctgctgcgcaccgtttatcagtacatgtcgcagcagctgaaaaag
aagtgcatctcggagcgcgaccgcttcccggaggataagcggtccattatcacgcagatg
cccaagtttttggaggcattgcgggctgaactgctcaaggatgattctcccatctgggat
ccaaactaccgcccgccaaattcgttcgtcatccagcagcggaagcggcatcaggaggtg
acgccttctgtggccggcgtcagtgctgtctcgctgggaaccagtaagcgttccagcgtg
ggcgaacctctccacaagcggccaaagaaggaatcactcgagcggagcaccacaagtgag
agtgtggatgacctgcccaccgatgtggttatgcgtgccatgaaatcggtatcggaatca
aagacaaccaacaagtcggagatactcttccccgtgaatgtgtcccgggacgaaaacgtg
aaggccgaggagcagaagcgcgccattgagttccatgtggtgggcaactcgctgaccaag
ccagtggacaagcagacggagctgtggcttttgggcctgcaactggtgtttgcgtaccaa
ctgcccgagatgccacgcgagtacatcagccagctggtcttcgacaccaagcacaagacc
ctggccctgatcaaggagaatcagcccatcggtggcatttgcttccgcccctttccatcg
cagggcttcaccgagatcgtattctgtgccgtgaccatgtcggagcaggtgaaggggtat
ggaacgcatctgatgaaccacctgaaggactacagcatccagcgaggcattaagcatttg
ttgacatttgccgactgcgacgccatcgggtactttaagaagcagggattctccaaggac
atcaagctggctcgtcccgtctatgcgggctacatcaaggagtacgacagcgccactctg
atgcattgtgaactgcatccgagcatagtgaacacccagttcattgccgtgattcgcaac
cagagcgagattctcaaggagctcatagcccagcgccacaatgaagtccagaaagtcagg
ccgggattgacatgcttcaaggagggtctgccatcgattcctgtcgagtcgattcccggg
ctacgggaaatcggttggaagccacaagtgcgtccagcgagatcttcgcgacccctggag
gagtcatccgatcccgagaagctggctacttcttttgcatccgtgttgcagtccgtgcgc
caacacaccacagcctggcccttcctgcgaccagtgactgccgcggaagtgccggactac
tatgatcacatcaagtatccgatggatctgaaaaccatgggggaacggctgaagaaaggg
tattaccagacgcgccgcctgttcatggcggatatggcgcgtatatttttaaactgtcgg
ttctacaactcgcccgacacggagtattatcggtgcgccaactccctggagcgttactac
caaacgaaaatgcgcgaattgggactctgggacaaatga

DBGET integrated database retrieval system