KEGG   Drosophila ananassae: Dana_GF24152Help
Entry
Dana_GF24152      CDS       T01059                                 

Definition
GF24152 gene product from transcript GF24152-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dan  Drosophila ananassae
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:dan04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 999 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVNDLSALISNSSRKMDKSTVLKSTIAFLKN
HNEAADRSKVFEIQQDWKPAFLSNDEFTHLMLESLDGFMMVFSSMGSIFYASESITSQLG
YLPQDLYKMTIYDLAYEMDHEALLNIFQNPAPVIEARQTDIGANNQITFYTHLRRGGLEK
VDSNAYELVKFVGYFRNDANTNAGSSGDSQSGGSGGNGQPAVLPRIFQQNPNVEVDKKLV
FVGTGRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGY
DYYHFDDLDSIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTAYYVTYHTFNSKPEHVV
CTHKVVSYAEVLKESQKERKAISSTGNSSKSASATTTLRDFELGNQNLDSTLLGNSLANL
GNEAAATSPTIDSSPMWSASAAQASGSCQINPLKTSRPASSYGNISSTGISPKAKRKNYF
SNRGNESDSTSISADSVTSRQSLMTHVSSQSHRQRSHHRDHHHHQQQQQNQQQHQHQQQQ
HQQQQHQQHQQQFQQHLQQNVSGPKIVPLLPIAPGSLMANNACQFPQQAYPLASPQLVTP
TFLEPPQYLTAIPMQPVIAPFSVAPVLSPLPVQGQSGDLLPGTVVMTPTQSQLQDQLQRK
HDELQKLIMQQQDELRIVSEQLLLARYTYLPMPMGFAAGNMAATAMGNMAGGGGQRGLNF
SSSNAVQPQFNQYGFALNSEQMLNQQDQQMMMQQQQNLHNQQQHNLQQQHQSQAQLQQHH
QQQNQQQQQQQQNQQQQQQHQQQHQQQQLPLPNDEMLSSQEMEEINAILNMSPLPSMGSQ
LNTSGNNNNQNYNGGSNQNGNQNNNNNGNSNAPQNTNEDSLLSYMQMATESSPSLNFHMG
ISDDGSETHSEDNKLMHSNSSNQMQQHQQQQQQMMQQQQQQQQQQQSNNFFSSNHFLNNS
QNQNQNQLPNDLEILPYQMSQEQSQNLFNSPHTAPGSSQ
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgatgacaaggatgatacgaaaagaaagtcgcgcaacctaagcgag
aagaagcggcgggatcagttcaattcgttggtgaatgatctgagcgccctcatatccaac
tccagtcgcaaaatggacaagtccacggttcttaaatccacaatagcctttctgaagaat
cacaatgaggctgcggacaggtcgaaagtttttgaaatccaacaagactggaagcctgcg
tttctgagcaacgatgagtttactcatttgatgctggaatccctcgacggcttcatgatg
gtctttagcagcatgggctccattttttatgcctcggaaagtattacctcacagctgggt
tacctgccgcaagacctttacaaaatgaccatctacgacctggcctatgagatggaccac
gaggcgcttctgaatattttccagaatcctgctcccgtgatcgaggcgcgacagacggac
attggagccaacaaccagatcacgttctacacgcacctgaggcgaggcggcctggagaaa
gtggactccaatgcctacgagctggtcaagtttgttggttactttcgtaatgatgccaat
accaatgcaggatccagtggagacagccagagtggaggatctggtggaaatggccagcca
gctgtgttgccaaggattttccagcagaaccccaatgtcgaggtggacaagaaactggtg
tttgtgggaacaggacgtgtccagaatccgcagctgatccgggaaatgagcatcatcgat
ccgacgagcaacgagttcacctcgaagcacagcatggagtggaagttcctattcctggat
catcgagcgcctcccataataggatacatgccgttcgaggtgctgggcacctctgggtac
gattactatcattttgatgatctggacagtattgtggcatgccacgaggaattacgacag
actggcgaaggcaaatcctgttactatcggtttcttaccaagggtcagcagtggatctgg
ctgcagacggcctactacgtgacttaccacaccttcaactccaagccggagcacgtggtc
tgcacccacaaggtggtcagctatgcggaggtccttaaggagagccagaaggagcgcaag
gcgatatcctccaccggaaacagcagcaaatccgcctcagccaccaccactctcagggat
ttcgagttgggcaaccagaatctggacagcacgttgctgggcaacagtttggccaatctg
ggcaacgaagccgccgccacatcgcccaccatcgactcatcgcccatgtggtcggcatcg
gcggctcaggcctccggctcctgccaaataaatcccttgaagacatctcgtccagcctcc
agttatggtaacatcagctccacgggcatctcgccgaaagccaagcggaagaattacttc
agcaatcggggaaacgagtcggactccacctcgatatcagcggattcggtcaccagcagg
cagtccttgatgacacatgtgagctcgcaaagccatcggcagcgatctcatcaccgggat
catcatcaccaccagcagcagcagcagaatcaacagcaacaccagcaccaacagcagcag
catcagcagcaacagcaccagcagcatcaacagcaatttcaacaacacctgcagcagaat
gtcagtggccccaagatagtaccccttctcccgattgctcctggctcgttgatggccaac
aatgcctgccagtttccacagcaggcctatccactggccagtccgcagctggtgacgccc
acgtttctggaaccgcctcaatacctcaccgccatacccatgcaaccagttattgctccg
ttttcggtggcacctgttctctcgccgctgccggtccaggggcagtccggggatctgctg
ccggggacggtggtaatgacacccacccagagccagttgcaggatcaactgcaacgcaag
cacgacgagttgcaaaagctcataatgcagcagcaggacgagctgaggattgtgtccgag
cagttgcttctggcccgatacacgtacctgccaatgccgatgggatttgcggccggcaat
atggctgccacggccatgggtaacatggcggggggtggtgggcaaagggggctcaacttc
tcaagcagcaatgctgtccagccgcagttcaatcagtatggattcgcattaaattccgag
cagatgctcaatcaacaggatcagcaaatgatgatgcaacagcaacagaatctacataac
cagcagcagcataatctgcagcaacagcatcagagtcaggcacaattgcagcagcatcac
caacaacagaatcaacagcagcagcaacagcaacaaaatcagcaacaacagcagcagcat
cagcagcaacatcaacaacagcaattgccgttgccaaacgatgaaatgctatccagccaa
gaaatggaggaaataaacgccattttaaatatgtcgccattgccttcaatgggatctcag
cttaataccagtggcaataacaacaatcagaattacaacggtggcagcaatcagaatggc
aaccagaacaacaacaacaatggcaactcgaatgctccacaaaatacgaatgaagattct
ttgctgtcttatatgcaaatggccacagaatcgagtccttcgctcaacttccatatgggc
atcagtgacgatggctcggagactcacagtgaagacaacaagctgatgcacagcaacagc
agcaatcagatgcagcaacatcagcagcagcagcagcaaatgatgcagcaacaacagcag
cagcaacagcaacagcagtccaataacttctttagctccaatcactttctcaacaatagt
cagaatcagaaccaaaatcagttgccaaacgatttggaaatattgccataccagatgtcc
caggagcagtcgcagaatctatttaactcacctcacacagcacccggcagcagtcagtag

DBGET integrated database retrieval system