KEGG   Drosophila ananassae: Dana_GF24161Help
Entry
Dana_GF24161      CDS       T01059                                 

Definition
GF24161 gene product from transcript GF24161-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 430 aa AA seqDB search
MSPKSQWAWVLLSALLLALGSAAVSSRVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRSRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFMFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATGEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETIFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRPRYHGKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPDDDPLQMTPQALHLFLESIVNESAVA
YGGDTYFVRLNRALFEVRRSLRDMWQGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPEEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaaagtctcagtgggcttgggttctcctgagtgctctcctgctggctttggga
tcggcggcggtatcttcgcgcgttctggaactgagtgatcgcttcatcgatgtgagacat
gagggccagtggctggtgatgttctacgcgccatggtgcggctactgcaagaagacggag
cccatcttcgctctggtggctcaggcgcttcatgcgacaaatgtgcgagtgggccgcctg
gattgcaccaagtatccagctgctgccaaggagtttaaggttcgtggctatcccactatt
atgttcatcaagggaaacatggagttcacctacaacggagaccgtagtcgcgatgaattg
gtggactatgccttacgaatgtctggtcccccggttcaattagtcacgcgaactgagagc
gtggatatgctgaaaggatcccacacgatcttctttatgtttgttggccagcaggagggt
gtggtgtgggacacgtactatgcggcggcggaaggataccaagagcacggattcttttac
gccaccggtgaagatattgccgctcagcactttgactttgagaaactgccagcagttatt
gtttacaaagaggagcaacaccacttttatccccacggccacttggcgcacgaaatggat
cccaatgaagttaacgagaccatctttcagtgggtgaatgtggagaggttcaccttgttc
ccgaaggtcactcgattcaatatccatcagttgctaaaaaccaacaaatatttggttctg
gctgttgtccaggaggacaagctcaatcaaatagccacacatgagctggagttccgtgat
atggtcgagggagtgatacgaaagcatcgtcctcggtatcatggcaaattccaattcgga
tggattggagagccctccatagcccattctattattctcgaccaactgcctaccccgcat
ctgattgccataaactcaagcacccagcaccattttatacctgacgacgatccactgcag
atgactccacaggccctgcatctgttcctggagtccattgtcaacgaaagtgccgtggcc
tacggcggagatacgtactttgtgcgcttgaatcgagctttgttcgaggtgcgaagatcc
ctgagggatatgtggcagggtaatcctgttctgaccaccgtcatttttgggcttcccctg
ggattcctttcactaattatgtactccatattctgtggcgattgcttggttacggaggaa
gacccagaagaggaccacgagaaaaaggagtaa

DBGET integrated database retrieval system