KEGG   Drosophila ananassae: Dana_GF24241Help
Entry
Dana_GF24241      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  
replication factor A2
Organism
dan  Drosophila ananassae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dana_GF24241
   03420 Nucleotide excision repair
    Dana_GF24241
   03430 Mismatch repair
    Dana_GF24241
   03440 Homologous recombination
    Dana_GF24241
   03460 Fanconi anemia pathway
    Dana_GF24241
DNA replication proteins [BR:dan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dana_GF24241
DNA repair and recombination proteins [BR:dan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dana_GF24241
   MMR (mismatch exicision repair)
     Dana_GF24241
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dana_GF24241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MNDSFGDFNATQTAPAGAASSQKGEGIVPLVVKQIVDAPEGNIEMFGMQYAMACVVGIVR
NIETSSTKITYTLEDHSGRIDAHYWLEEGDTLKAPEVMVNNYVKVYGTTRSQAGQKTLMV
FKLLPILDPNEVCTHLLEVLNARYKAEDYQSKGGATGGAAYSGAGSIADFTASQSNAIVS
GLDPKQQAVFQAIKGNVSEEGISRKELKAKFSHISNSELNNILDFMISEGHIYSSIDADH
FICTM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcttttggtgatttcaatgccactcagacggcaccggctggagcggccagc
agtcaaaagggagagggtatagttcccttggtcgtgaagcagattgtggacgctcctgag
ggaaacatcgagatgtttggcatgcaatatgcgatggcctgtgtggtgggaattgttcga
aatatcgagacctcttcgacgaagattacatacaccctggaggaccacagcggcaggatc
gatgcacactactggttggaagaaggcgacactctcaaggctcccgaagtgatggtcaac
aactacgtaaaggtgtatggtacaacgcgctcccaggcgggccaaaagacgctaatggtg
ttcaagctgctgcccattttggatcccaatgaggtgtgcacccacctcctggaagtgctc
aacgcgcgctacaaggcggaggactaccagagcaagggtggagcaactggtggtgctgca
tattcaggagcgggctccatcgcagacttcacagcttcgcagagcaacgccattgtcagc
ggattggatcccaaacagcaggctgtgttccaggccataaagggcaacgtttccgaagag
ggaatcagtcgcaaggagcttaaagccaagttctcgcacatcagtaactccgaattgaac
aatattctcgacttcatgatctctgagggtcacatttactccagtattgatgcggatcat
tttatatgtacaatgtaa

DBGET integrated database retrieval system