KEGG   Drosophila ananassae: Dana_GF24241Help
Entry
Dana_GF24241      CDS       T01059                                 

Definition
GF24241 gene product from transcript GF24241-RA
Orthology
K10739  
replication factor A2
Organism
dan  Drosophila ananassae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dana_GF24241
   03420 Nucleotide excision repair
    Dana_GF24241
   03430 Mismatch repair
    Dana_GF24241
   03440 Homologous recombination
    Dana_GF24241
   03460 Fanconi anemia pathway
    Dana_GF24241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 245 aa AA seqDB search
MNDSFGDFNATQTAPAGAASSQKGEGIVPLVVKQIVDAPEGNIEMFGMQYAMACVVGIVR
NIETSSTKITYTLEDHSGRIDAHYWLEEGDTLKAPEVMVNNYVKVYGTTRSQAGQKTLMV
FKLLPILDPNEVCTHLLEVLNARYKAEDYQSKGGATGGAAYSGAGSIADFTASQSNAIVS
GLDPKQQAVFQAIKGNVSEEGISRKELKAKFSHISNSELNNILDFMISEGHIYSSIDADH
FICTM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcttttggtgatttcaatgccactcagacggcaccggctggagcggccagc
agtcaaaagggagagggtatagttcccttggtcgtgaagcagattgtggacgctcctgag
ggaaacatcgagatgtttggcatgcaatatgcgatggcctgtgtggtgggaattgttcga
aatatcgagacctcttcgacgaagattacatacaccctggaggaccacagcggcaggatc
gatgcacactactggttggaagaaggcgacactctcaaggctcccgaagtgatggtcaac
aactacgtaaaggtgtatggtacaacgcgctcccaggcgggccaaaagacgctaatggtg
ttcaagctgctgcccattttggatcccaatgaggtgtgcacccacctcctggaagtgctc
aacgcgcgctacaaggcggaggactaccagagcaagggtggagcaactggtggtgctgca
tattcaggagcgggctccatcgcagacttcacagcttcgcagagcaacgccattgtcagc
ggattggatcccaaacagcaggctgtgttccaggccataaagggcaacgtttccgaagag
ggaatcagtcgcaaggagcttaaagccaagttctcgcacatcagtaactccgaattgaac
aatattctcgacttcatgatctctgagggtcacatttactccagtattgatgcggatcat
tttatatgtacaatgtaa

DBGET integrated database retrieval system