KEGG   Drosophila ananassae: Dana_GF24241Help
Entry
Dana_GF24241      CDS       T01059                                 

Definition
(RefSeq) GF24241 gene product from transcript GF24241-RA
  KO
K10739  
replication factor A2
Organism
dan  Drosophila ananassae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dan00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dana_GF24241
   03420 Nucleotide excision repair
    Dana_GF24241
   03430 Mismatch repair
    Dana_GF24241
   03440 Homologous recombination
    Dana_GF24241
   03460 Fanconi anemia pathway
    Dana_GF24241
DNA replication proteins [BR:dan03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dana_GF24241
DNA repair and recombination proteins [BR:dan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dana_GF24241
   MMR (mismatch exicision repair)
     Dana_GF24241
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dana_GF24241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MNDSFGDFNATQTAPAGAASSQKGEGIVPLVVKQIVDAPEGNIEMFGMQYAMACVVGIVR
NIETSSTKITYTLEDHSGRIDAHYWLEEGDTLKAPEVMVNNYVKVYGTTRSQAGQKTLMV
FKLLPILDPNEVCTHLLEVLNARYKAEDYQSKGGATGGAAYSGAGSIADFTASQSNAIVS
GLDPKQQAVFQAIKGNVSEEGISRKELKAKFSHISNSELNNILDFMISEGHIYSSIDADH
FICTM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcttttggtgatttcaatgccactcagacggcaccggctggagcggccagc
agtcaaaagggagagggtatagttcccttggtcgtgaagcagattgtggacgctcctgag
ggaaacatcgagatgtttggcatgcaatatgcgatggcctgtgtggtgggaattgttcga
aatatcgagacctcttcgacgaagattacatacaccctggaggaccacagcggcaggatc
gatgcacactactggttggaagaaggcgacactctcaaggctcccgaagtgatggtcaac
aactacgtaaaggtgtatggtacaacgcgctcccaggcgggccaaaagacgctaatggtg
ttcaagctgctgcccattttggatcccaatgaggtgtgcacccacctcctggaagtgctc
aacgcgcgctacaaggcggaggactaccagagcaagggtggagcaactggtggtgctgca
tattcaggagcgggctccatcgcagacttcacagcttcgcagagcaacgccattgtcagc
ggattggatcccaaacagcaggctgtgttccaggccataaagggcaacgtttccgaagag
ggaatcagtcgcaaggagcttaaagccaagttctcgcacatcagtaactccgaattgaac
aatattctcgacttcatgatctctgagggtcacatttactccagtattgatgcggatcat
tttatatgtacaatgtaa

DBGET integrated database retrieval system