KEGG   Drosophila ananassae: Dana_GF24297Help
Entry
Dana_GF24297      CDS       T01059                                 

Definition
GF24297 gene product from transcript GF24297-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dan  Drosophila ananassae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dana_GF24297
Enzymes [BR:dan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dana_GF24297
Peptidases [BR:dan01002]
 Cysteine Peptidases
  Family C44
   Dana_GF24297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 558 aa AA seqDB search
MCGIFAIFSRDGEPIPPQFLNGSKHSLRELAYRQSGKQRHRGPDSTGVHVIPSDGVAMVH
ERLRIVGVAMGDQPFISEDGNLVLVANGEIYNYLELAADIAKRRGTYKPKSDCHVILELY
QDYGADLLQYITGMFAFALYDRRTKEVLIARDPFGIIPMYVGEDKAGNLWVSSEMKCLVD
TCPKVETFTPGEARFGKVGELKTCWTFQQPWIKEVPNQPCNLALLRSIFESAVRSHLHCD
VHFGALLSGGVDSSLVASIATKIMRERDPNYRLKTFSVGLRDAPDFKAARHVAKYIDSDH
KEIIFEIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNYKDFHEELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPEDKIPGPLNQYGGEQQKRLEKFILRAAFADNYLPDDVLWRQKEQFSDGVGYDWIDSI
RRVATGHVTDEEFAGAALRFPFNTPTTKEAYYYRSIFAEQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQVHKD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttttgcaatattttcccgggatggagaacctattcccccgcaatttctc
aacggcagcaagcacagccttcgggaactggcttataggcagagtggaaaacaacggcat
cgtggtcccgactccacaggcgtccatgtaattccctccgatggggtggccatggtccat
gaacgcctgcgaattgtgggcgtggccatgggggatcagcccttcatctcggaggacggt
aacctggtcctggtggccaacggagaaatctacaactacctggaactggcggcggatatc
gcgaagcgtcgtggcacttacaagccgaagagcgattgccatgtgatcctcgagctctat
caggactacggtgctgaccttctgcagtacataaccggaatgtttgccttcgctctgtac
gataggaggaccaaggaggtcctgattgccagggatcccttcggcatcataccaatgtat
gtgggtgaggataaagcgggaaatctctgggtatcctcggagatgaagtgcctggtcgat
acctgtcccaaagtggaaaccttcacgcctggcgaagcacgattcggaaaggttggtgaa
ctgaagacatgttggacgttccagcagccatggatcaaggaagtgcccaaccagccctgc
aacctggccctgctccgctccatttttgagtcggcggtgcgaagccatctccattgcgat
gtgcactttggtgcccttctttccggcggtgtggactccagcttggttgcttcgatagcc
accaagattatgcgggaacgggatccaaactacaggctgaaaaccttctcggtgggtctg
cgggatgccccggacttcaaggctgcgcgccacgtggccaagtacatcgatagcgaccac
aaggagatcatcttcgagattgacgaggcgctggacgggatcagggatatcgtgtaccat
ctggaaacctacgacgtcaccactgtgcggtgcagtctgcccatgttgctgctggccagg
tacatcaagagcactggtatcaagatgatcctgtcgggcgagggtgccgatgagatcttc
ggaggatacctctatttccacaaggctcccaactacaaggacttccacgaggagctggtg
aaaagggttcaacagctacacctatcagactgcctacgggccaacaaagtggccatggcc
aagggggtggagctgagggtgcccttcctggacacaggattcgtcaaccatgtgatgcag
atcagaccggaggataagattcctggacctctcaaccagtacggcggagagcagcagaag
cgtctggaaaagttcatcctgcgagctgcctttgcggacaactatctgccggacgatgtc
ctgtggcggcagaaggagcagttctcggacggtgtgggctacgactggatcgacagtatc
cgacgggtggccaccggtcatgtgaccgacgaggagtttgcaggagcagctctccggttt
ccattcaacactccaaccaccaaggaggcgtactattatcgcagcattttcgccgagcag
tttcccggggaatcggctgcccggaccgttgtgaggtgggtgccacggctcgattggggc
tgcccagaggatccttccggcagggcccaggctgtccaccaggttcacaaagactga

DBGET integrated database retrieval system