KEGG   Drosophila ananassae: Dana_GF24416Help
Entry
Dana_GF24416      CDS       T01059                                 

Definition
GF24416 gene product from transcript GF24416-RA
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1508 aa AA seqDB search
MAQQTQPQQQQQQTAPPPSSSSSTLTGAAAAGGAGGDTVAPLSAPSTPQPSTVSGNNNNN
TIVSPSGNNNVLTPVHALATAGQPVFNQMYMPAHAAHPHAGPPYPAMMPAHIPNVFVNNV
TANVNLHGWSHSVPPNYLPGAQPHYIGPGDMAQEQGNTLMPHMQPLPINLAPQGGSPNPH
NPAMGGGRPRGRDRGRGGGGNRRNDYHGPRHLQQRQQQHIVSMAPQQQLVPPDGVQGSNP
GMQLQPELGQQLAPLPEQMQHMPYYATAPPHAYAYGPYPSTYFAPQHAPLQPPNSAAQQA
TGTPLFISPVMYNPICLGGYYYPQMMHPAEYPYLPEDAGQAGVDERVPQPDGGMPPMWHS
APMYAEEYAEVLQQQQQQQQQVAVVHANGVAPADEINHNSSSLPSSETSSMLSPNYQIYD
PQMHDIHHQMGVMQIYDDGQMATLQPIHPGAAPVQQYEDELSECGVVPPPGAIPVTWAAA
MPVPAEAAPQALLQAPPTHHIMQQTSPVLIEQQPQLVPAPPQAETPTPQHQPPQEHLADK
NLINNNKEAVVALEEKLASEKQQQLDQDYHQQVQVQQQQQPLPTKVPNLVVATVAPQLQH
QPPVQQQQPAPQQHQQQQTSPVVQHQHQPPQQQPPQQQQQQSSYHEQHHQQQQHQQQQQQ
PQRKPPQQYNQSQQHQQVRRKYSSEYNHHHHQHSNSNSSDTGIQTTKTMSWTNSAQHKKS
TQSVSVTASPNSVNGPGVGVGVGVGPTTTVNQKSNYSHTTKTFTNQQHYQHQQQHYHNQN
NYNSNNSSSNSNSSLNNNNNVKNNQPQVRNYGTMKVPSSPVASTAPTLERKNSQQGSAGV
APATTSAASSAIPAAITTATTSTASITATPNQFQQETATQAAPPPIASASAPAAATIITA
TAPPKSYATKKHQSYEPPVLSTVVASTPSSSNPQPPLNLAPPAPPASQNSGESAQLSWAS
LFVSNKPVAKVAPYEATKPPQQQPQHPVMQLAPPQPAPVAVTTTPQQLQLAPPQSAPLLT
THQQSQLPAPVPAPTVPLVTPGALSYSAASAQAVPASLPSPASVSVKPLKQEVVRPAQQL
DEWTNKYAEYLTRHKTYFAPISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQ
AAVLSEVKTPTVNAMMSFMSNFSSLPSGLRLRLNTLNKGSQNKGKDEFVGSDLQCDMAFE
PTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPSAQQNGQDQSEP
EDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREGEHSTDVIQPFFTLQ
LNIEKAASVKEALEILVGRDQLEGVTGSKTKQEVVAWQQMTLEKLPVVLILHLKYFDYRS
DGCTKILKKVEFPVELKIDAKILGSKKTAQKQRAYRLFAVVYHDGKEASKGHYITDVFHS
GYSSWLRYDDSSVKPVSEKNVLQPHTPRVPYLLYYRRSDTLPQQTQSQQTNGGGSGPVGS
SSSNAGDK
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacgcagccgcaacagcagcagcagcagacagcgccgccgccgtcgtcg
tcgtcgtcgactttgacgggagctgccgcagcgggaggagccggtggtgacacagttgcg
cctctatccgccccctcaactccccaaccatctacagtcagtggcaataacaacaacaac
accattgtctctccatcgggtaacaacaatgtgctgactcctgtccacgctctggccact
gccggccagccggtcttcaatcagatgtacatgcccgcccatgcagcacatccgcacgct
ggaccgccctatccggccatgatgccggcgcacattcccaacgttttcgtgaacaatgta
actgccaatgtgaatctgcatgggtggtcgcactctgtgccgcccaactacctaccgggt
gcccagccgcactacattggtcctggcgacatggcccaggaacagggcaacaccctgatg
ccgcatatgcagccgctgcccattaatcttgccccacaaggtggcagtcccaatccccat
aatccggccatgggcggtggtcgtccccggggtcgggaccgtggtcgtggtggcggaggc
aaccggcgcaacgactaccatggaccacgtcatctccagcagaggcaacaacagcacatt
gtttccatggcgccgcaacagcaactggtaccgccggatggcgtccaaggatccaatccg
gggatgcaactccagccagaactgggccagcagttggcccccctgccggagcagatgcag
cacatgccgtactatgccactgcgccgcctcacgcctacgcctacgggccctatccttcg
acctactttgcgccgcagcatgcaccgttgcagcctccgaactccgctgctcaacaggcc
accgggacgcccctgttcatatccccggtgatgtacaaccccatttgcttgggaggctac
tactacccgcagatgatgcatcccgcggagtacccgtatttgccggaagatgccggccaa
gccggagtggatgaacgtgttccgcagccggatggaggaatgccgcctatgtggcactcg
gcccccatgtacgccgaggaatatgccgaggtactgcagcaacaacaacaacagcagcaa
caggtggctgtggtgcacgccaacggagtggctccggcggacgaaatcaatcacaacagc
tcgtcgctgccctcgtcggagacgtcgagcatgctcagcccgaactaccagatctacgat
ccccaaatgcatgacatccaccaccaaatgggcgtgatgcagatctacgacgacggtcag
atggccacgttgcagccgatccacccaggtgccgctcccgtgcagcagtacgaggatgaa
ctctcggagtgcggcgtcgtccctcctccgggagctattcctgtgacctgggcagctgcc
atgcccgtgcccgctgaggctgccccgcaggcgctcctgcaggcgccacccacccatcat
atcatgcaacagacgtcgcccgtcctcatcgaacagcaaccgcagctggttccggcaccg
ccacaggcagagacacctactccccagcaccagccgccccaggagcatctggctgataaa
aacttgataaacaacaacaaggaggcggtggtggccctggaggagaagttggccagtgag
aagcaacagcaattggatcaggactaccatcagcaggtgcaggtgcagcagcagcaacaa
ccattgccaacgaaagtgccaaaccttgttgtagcaacagtggcacctcaactgcaacac
cagcctcctgtgcagcagcaacagccggcaccacagcaacatcagcagcagcaaacatcg
ccggtggtgcagcaccaacaccagccgccccagcagcagccgccccagcagcagcaacaa
cagtccagctaccatgagcaacatcatcagcaacagcaacaccaacagcagcaacagcaa
ccgcagcgcaagccgccacagcaatacaatcaatcccagcagcaccagcaggtgcgtcgc
aagtactcctcggaatacaatcaccaccaccaccagcacagcaacagcaacagcagcgac
actggcatccagaccaccaagaccatgtcctggacgaactctgcccagcacaagaagtca
acgcaatcggtttccgtcacagcctctcccaatagcgtaaacggcccaggagtgggagtg
ggagtgggtgttggaccaacgacaactgttaaccaaaagagcaattatagtcacaccaca
aagacgttcaccaatcagcagcactaccagcaccagcagcagcactaccacaatcagaac
aactacaacagcaacaatagcagcagcaacagcaacagcagcttgaacaacaacaacaat
gtgaagaacaaccagccacaagtgcgtaactatgggaccatgaaggtgccatcatcgccg
gtggccagcacagctcccacgctggagaggaagaacagccagcagggtagtgcaggagtt
gcgccagccaccacatcggcagcatcgtcggccatcccagcggcaatcacaacagcaact
acctcaacggccagcataacggccacgccgaaccaattccaacaggagaccgccacccag
gccgctccgccgccaattgctagtgcaagtgccccggcagcagccaccatcatcaccgca
acagcaccaccaaagtcgtatgcgaccaaaaagcaccagagctacgagccacctgtcctc
agcaccgtggtggcctccactcccagttcatcgaatccgcaaccgccgctgaatcttgcg
ccgcccgcaccaccagcctcgcagaacagcggcgagagcgcccagctctcgtgggccagt
ctgtttgtcagcaacaagccagtggccaaggtggctccctacgaagccaccaagcctcct
cagcagcagccacagcatcccgtgatgcaactggctccgccacagcctgccccggtggcg
gtgaccaccacgccccagcagctccagctggccccaccacagagtgcaccactgctgact
acccaccagcaatcgcagctgccagccccagttcctgctcccacagttcctttggtcaca
cccggagctctatcctattcggcggcatccgcccaagcggtacccgcttcgctgcccagt
ccggcctccgtttccgtcaagcccctgaagcaggaggtggtgcgtcctgcccagcagctg
gacgagtggaccaacaagtacgcggaatacctgacccgccacaagacctactttgcgccg
atcagcctgcgcccgcggggcctgaccaaccggtccaactactgctacatcaactccatc
ctgcaggccctactgggctgctccccgttctacaacctgctgcgatccattcccaagcag
gcggctgtcctcagcgaggtgaagacgcccacagtgaacgccatgatgtcctttatgtcc
aacttctcatcgctgcccagcggcttgcggctgcgactcaacactctgaacaagggatcc
caaaacaagggaaaggacgagttcgttggctcggacttgcagtgcgacatggccttcgag
cccactgagatctacaagctgtggaacgacagtcgtgaggagcacgtcgagggacgccag
gaggatgctgaggagttcctgggatatgtgctcaacaagctcaacgatgagatgcttgag
gtgatcaagctgattgacaagcccagtgcccaacagaacggccaggatcagtccgagccg
gaggatggcggcgatgtttggcagatgatatgcaacaaccgcaacaagggcagtgtcacc
cgtcagactgacttcggacgcactccggttagcgatattttccgcggagagctgcgatcc
cggctgcagcgcgagggcgagcactccacagatgtgattcagccgttcttcacgctccag
ttgaatattgagaaagctgcctcggttaaggaggccttggagatcctggtcggtcgcgac
cagctggagggtgtcactggcagcaagaccaaacaggaggtggttgcctggcagcagatg
actctggagaagctgcccgttgttctgatattgcatttgaagtacttcgattaccgatcg
gatggatgcacaaagatcctcaagaaggtcgagttccccgtggagcttaaaatagatgcc
aagatccttggatcgaagaagaccgcccagaaacagcgggcctaccgcctctttgccgtc
gtctaccacgacggaaaggaggcctccaagggacactatatcacggacgtattccactcc
ggctacagcagctggctgcggtatgacgacagctcggtgaagccggtcagcgagaagaat
gttctccagccgcacaccccacgggtgccttaccttctgtactatcgtcgctcggacact
ctgccccagcagacgcaaagccagcagacgaacggcgggggatccggtccggtgggcagc
tcctcctccaatgccggcgacaagtga

DBGET integrated database retrieval system