KEGG   Drosophila ananassae: Dana_GF24533Help
Entry
Dana_GF24533      CDS       T01059                                 

Definition
GF24533 gene product from transcript GF24533-RA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 649 aa AA seqDB search
MTIKPVSAPPSAKRVPANVDPDNKEAQVVVVEQSVVSQTHRNVVIDGHGQSPQRRGEVYD
ELARTHRCSPHKSTRSKRRDHHDSHAHHHKRDRLEREKLNHTAGGVGSGAIPGVAGSKCN
SPPLASTSGSSSPSAVGRNSPEHLAVPKAQSQLSPATAAANLLKSVEETFSGYNSGDEHL
QPKERKIPAEEWQRRDVEFAKCMEKRGYELKPVEEDGACLFRSISLQIYGDEEMHDVIRQ
HTMDYIHENREYFGQFVTEDINSYIQRKRARDAHGNHIEIQAISEIYSRTVEVYCYQSNP
INIFNSEQSQAGYPPLRLSYQRGSHYNAILDPYNATVGVGLGLAGYKPEFQTKEAVRLSE
QLEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRDNMQRSRSNNTAAGSATSSTV
TSAEALTDSDASPSKYSTCGAVTGSSGNSAATLPSASGGDGPTASFSLSPKTLSQFAHKL
PPEVNDLPGYESDATDMSSTSSVGHCGGNSSPSQRSAKSSKSQRRTTALRKKRRHENREV
PLSGQNSADSLEAPLRKSPKRDSVPAATRAETPEAEQRPCTSKQSSNSPQKHGDAQSTSK
ENYSSFYQELLEASYANDGINESEMLQQAIQMSTRDYMEDQKRKYYCGP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaagccagttagtgcaccaccgagcgccaagcgtgtcccagccaatgtcgat
cccgacaacaaggaggcccaggtggtggttgtggagcagtcggtggtcagccagacgcac
cgcaacgtcgtcatcgatggtcacggacagagcccccagaggcgtggcgaagtctacgac
gaactggcacgcacccatcgctgcagtccccacaaaagcacccgttcgaagcgtcgcgac
caccacgacagccatgctcaccaccacaagcgcgatcgtctggagcgagagaagctgaac
catacggccggtggcgttggcagtggcgctataccgggagtggctggcagcaagtgcaat
agcccgcccctggcctccacatcgggcagcagcagtccgtcggcagtgggacgcaattcg
ccggagcatctggcagttccaaaggcccagagccagttgtcgccggcgacagcagctgcc
aatctcttgaagtccgtagaggagaccttctcgggctataacagtggcgacgagcacctg
cagcccaaggagcgcaagatcccggccgaggagtggcagcgtcgcgatgtcgaattcgcc
aagtgcatggagaagcgcggctacgaactgaagccggtcgaagaagatggtgcctgtctg
tttcggtccatttcgttgcagatctatggcgatgaggagatgcatgatgtgatccgtcaa
cacaccatggactatattcatgagaaccgcgaatactttggacaatttgtgaccgaggac
atcaatagctacatccagcgcaagcgtgctcgcgatgcccatggcaaccacatcgaaata
caggccatatccgagatttacagtcgcactgttgaagtttattgctatcagtcaaatcca
ataaatattttcaactcggagcagtcacaggctggttatccacccttgcgcttatcctat
cagcgtggctctcattacaatgctatattggatccatacaatgccaccgttggtgtgggc
ctcggcttggctggttacaagcccgagtttcagaccaaggaggcagtgcgtctcagcgag
cagttggaaatcgaacagaccatgtttgaagacaagctgaagacaacggattgggaggcc
accaacgaagccatcgaggagcagattgctcgcgagtcctacctgcaatggtgccgcgac
aacatgcaacgttcgcgcagcaataacacggccgccggctcggccacgtcctcgaccgtg
acctcagccgaagcgctcaccgactctgatgcctcgccctcgaagtattccacgtgtggc
gccgtcactggcagcagtggcaattcggctgccactttgccgagtgccagtggtggggat
ggcccgacagcctcgttttctttgtcgccgaagacactgagccagttcgctcacaaactt
ccgccggaggtcaatgatttgcctggctacgaaagcgatgccacggatatgagtagcacc
agctcggtgggacactgcggtggcaactcctcgcctagccagcgttcggccaagagttcc
aagtcccagcgtcgtaccacggccttgagaaagaagcgtcgtcacgagaatcgcgaggtg
cccttgtccggacagaatagtgccgattctctggaagctccacttaggaagagccccaag
cgtgattctgtgcccgcagcaacccgtgccgagacgccggaggccgagcagcgcccctgc
acctcgaagcagtcttccaactctcctcaaaagcatggggacgcccagtcgaccagcaaa
gaaaactactccagcttctaccaagaactgcttgaggcctcttatgctaatgatggcatt
aatgaaagcgaaatgctgcagcaggctatccagatgtccactcgcgactatatggaggat
cagaagcggaagtattattgcggaccgtaa

DBGET integrated database retrieval system