KEGG   Drosophila ananassae: Dana_GF24661Help
Entry
Dana_GF24661      CDS       T01059                                 

Definition
GF24661 gene product from transcript GF24661-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dan  Drosophila ananassae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MSDGAGNWCLIESDPGVFTELIREFGCEGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKDEDVYHFVGYMPIGGRLYELDGLR
EGPIDLGEIRPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIDKLLNP
GPNAMETEEDRQTEINNLRTYIQYEIQKKKRYKVENVRRKHNYLPFIVELLKMLGETGQL
MPIYEKAKQRALEREQAQRKKDSN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggtgctggcaactggtgtctcattgagtccgatccgggtgtgttcaccgag
ctaattcgcgagtttggctgtgaaggcgcccaagtggaggagatctggagtctggacagt
gagtcgttcaaaaacctggagcccattcatggcctgatatttctgttcaagtgggtgcaa
gaggatgagccggctggaaaagtggtcctggatcgggagaacatattctttgccaagcaa
gtgattaacaatgcatgcgccacccaggccatactgagtctgctcatgaacctggagcac
gaggacatcaagctgggcgagacgctgaccaacttcaaggagttctgccagtgcttcgat
ccctacaacaagggactgactctgagcaacgccagccagatccgcaccgttcacaattcg
tttgcccgccagacgctcttcgagctggacatgaagaaccagaacaaggacgaagatgtc
taccactttgtgggctacatgcccatcggtggccgactgtacgagttggatggcctccgg
gaaggacccatcgatttgggtgaaatccgtcctgagcagaactggatcgatgtggtgcgg
cccattattgagaagcgcatgcagcggtacagcgacggcgagattcacttcaatctaatg
gccctcatctcggaccggcagcggatctacgaacagcaaatcgacaagctgctgaatcct
ggtccgaacgccatggagaccgaggaggatcgccagacggagatcaacaacttacgcacc
tacattcagtatgagatccaaaagaagaagcgctacaaggtggagaatgtgcggcgcaag
cacaactacttgccgtttatcgtggagctgctgaagatgctgggcgagaccggacaactg
atgcccatttacgagaaggccaagcaaagggcgctggaacgcgaacaggcgcagcgaaaa
aaagactccaactag

DBGET integrated database retrieval system