KEGG   Drosophila ananassae: Dana_GF25061Help
Entry
Dana_GF25061      CDS       T01059                                 

Definition
GF25061 gene product from transcript GF25061-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dan  Drosophila ananassae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF25061
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dana_GF25061
   00603 Glycosphingolipid biosynthesis - globo series
    Dana_GF25061
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dana_GF25061
   00511 Other glycan degradation
    Dana_GF25061
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF25061
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dana_GF25061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 620 aa AA seqDB search
MKSSALGLALLLALVSQLTAHKSEDLIYGYECRSGLCRKVELSEENFAQAISLPVCRLFC
GSQIGTLWPQPTGAVRLDTLMRQVDISFIDINVNATVRKEKLWRAAEERWMEMLEAKIPD
RKILARGGYRMSVNINTPDDLALAKLTLETDESYNLEIDTDASGHVLANITARNFFGARN
GLETLAQLIVYDDIRREVQVTANVSISDAPVYKWRGLLLDTSRNYYSVKSIKRTLDGMAL
VKLNTFHWHITDSHSFPLEVRKRPELLKLGAYSPRQVYTRRDVAEVVEYGRVRGIRVMPE
FDAPAHVGEGWQHKNMTACFNAQPWKDFCVEPPCGQLDPTVNEMYDVLEDIYETMFEKFD
PDVFHMGGDEVSTNCWNSSRTIRKWMKKQGWGLATADFMRLWGHFQNEALARVDKVANNS
QTPIILWTSGLTEEPFIDENLNPERYIIQIWTTGVDPKIKKILERGYKIIVSNYDALYFD
CGGAGWVTDGNNWCSPYIGWQKVYDNNLKTIAGDYEHHVLGAEAAIWSEQIDEHTLDNRF
WPRASAMAERLWSNPSTGWKQAESRLLLHRERLVENGLGAEAVQPQWCLQNENECPIDAY
RRSGGRLWVVFLLMVSALSA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagtgcactcggactggctctgctcctggccctggtgtctcaactgacggcc
cacaaatccgaagacttaatttacggctatgagtgccggagtggcttgtgcaggaaggtg
gagctcagcgaggagaacttcgcccaggccattagcttgcccgtgtgccggctgttctgt
ggcagccaaatcggtaccttgtggccccagccgacgggcgcagtgcgtctggatacgttg
atgcgccaggtggacatctcgttcatcgacatcaatgtcaatgccaccgtccgcaaggag
aaactttggagggcggccgaggaacgttggatggaaatgcttgaagccaagatcccagat
cgcaagattctggccaggggtggctatcgtatgtctgtgaatatcaatacccccgatgac
ctggctctggccaaactcaccctcgaaaccgatgagagctataatcttgaaatcgatact
gatgcatccggtcatgtgctggccaatattaccgctcgcaatttctttggtgcccgcaac
ggcctggagaccctggcccagttgattgtttatgatgacatcagacgcgaagtccaggta
actgcgaatgtctctattagcgatgccccagtgtacaaatggcgcggtctgctcctggac
acctcccgaaactactactcggtgaagtctatcaagaggacattggatggaatggccttg
gtgaaactgaacaccttccactggcacattacggactcgcacagtttccccttggaggta
cgcaagcgtccggagctccttaagctcggagcctattcaccccgtcaggtgtatacccgc
cgggatgtggccgaggtggtggaatacggacgtgtgcgcggaatccgggtgatgcccgaa
ttcgatgctcctgcccacgttggcgagggatggcagcacaagaacatgacagcctgcttt
aacgcccagccttggaaggatttctgtgtggaaccaccctgtggtcagctggatcctacc
gtaaatgaaatgtacgacgtcttggaagacatctatgagacaatgttcgagaaattcgat
cccgatgtcttccatatgggcggggatgaagtgtccacaaactgctggaacagcagccgg
actatccgcaaatggatgaaaaagcagggatggggtctcgcaaccgctgactttatgcgg
ctgtggggccacttccagaatgaggcacttgctcgagtggacaaagtggccaacaattca
cagacgcccatcattctatggaccagtggtttgactgaggagccctttattgacgagaac
cttaacccagagcgttacatcattcagatctggacaacgggtgtcgatcccaagattaag
aagatcctagagcggggctataagataattgtatccaactatgatgccttgtacttcgat
tgtggcggcgctggctgggtcacagatggcaacaactggtgctccccctatattggctgg
cagaaggtgtacgacaacaatctaaagaccattgccggcgactatgaacaccatgtcttg
ggcgctgaggccgctatttggtcggagcaaatcgacgagcacacgctggacaaccgtttc
tggccgagagccagcgctatggctgagcgtctgtggtcaaatccctcaactggatggaaa
caggccgagtcccggttgctgcttcatcgcgaacggctagtggagaacgggctgggagcg
gaggcggtgcagccgcagtggtgcctccagaacgagaatgagtgtccaattgacgcatac
agacggagcggcggtcgactttgggtggtcttcctcctaatggtgtctgctctctctgcc
tga

DBGET integrated database retrieval system