KEGG   Drosophila ananassae: Dana_GF25085Help
Entry
Dana_GF25085      CDS       T01059                                 

Definition
GF25085 gene product from transcript GF25085-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dan  Drosophila ananassae
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dana_GF25085
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dana_GF25085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQSIPEDAINDESEDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRTYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSTSNINSNNKSDNDAGATAGTGSGSGSGSGSGTGAKGTKENNI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcatagcaaaaaacgcgtttgctactactacgatagcgacattggcaactac
tactatggccagggacatccgatgaagccacaccgcatacgcatgacccacaacctgctc
ctcaactacggactctaccgcaaaatggagatttaccgccctcacaaagccactgccgac
gagatgaccaagttccactcggacgagtacgtccgctttttgcgctccatccggccggac
aacatgaccgagtacaacaagcagatgcagcgcttcaacgtgggcgaggactgtcccgtc
ttcgacggcctctacgagttctgccagctgtccgccggtggatcggtggccgctgccgtc
aagctgaacaagcaggcctcggaaatctgcatcaattggggcggcggcctgcatcacgcc
aagaaatcggaagcctccggcttctgctacgttaatgatattgtgcttggaattttggag
ctactgaagtaccaccagcgtgttctctacatcgacatcgatgtgcatcacggcgacggt
gtggaggaggcgttctacacgaccgatcgagtgatgaccgtgagcttccacaagtacggc
gagtacttcccgggcaccggcgatctccgggacatcggtgccggcaagggaaagtactat
gccgtgaacataccactgcgcgacggcatggacgatgatgcctatgagagtatctttgtg
ccgattatcagcaaagttatggagacattccagccggcggcagtggtgctgcagtgtggc
gccgattccctcaccggcgatcgcctcggctgcttcaacctgacggtgaagggccatggg
aagtgcgtggagttcgtgaagaagtacaatctgccattcctgatggtcggcggcggtggc
tacaccatccgcaacgtctcccgctgctggacgtacgagacgtcggtggccctggccgtg
gagatcgccaatgagctgccctacaacgactacttcgagtactttggcccggacttcaag
ctccacatcagtcccagtaatatgacgaatcagaacacatccgagtacctggagaagatc
aagaaccggctgttcgagaacctgcgcatgctgccccatgcacccggcgtacagattcag
tcgatacccgaggacgcgatcaacgacgagtccgaggacgaggacaaggtagacaaggat
gaccgactgccgcagagcgacaaggataagcgcatcgtgccggagaacgagtactcggac
tcggaggacgagggcgagggcggcaggcgcgacaaccggacgtacaagggccagaggaag
cgaccgcgcctggacaaggacaccaacagcaacaaggcctcctcggagacttccagcgaa
atcaaggatgaaaaggagaagggtgacggagctgacggcgaggaatccacggcttccaac
acgaatagcaccagcaacatcaacagcaacaacaagagcgacaacgatgctggagcgacg
gccggcactggatctggctcgggctcaggatccggatccggaactggcgccaagggcacc
aaggagaacaacatatga

DBGET integrated database retrieval system