KEGG   Drosophila ananassae: Dana_GF25144Help
Entry
Dana_GF25144      CDS       T01059                                 

Definition
GF25144 gene product from transcript GF25144-RA
Orthology
K05635  
laminin, gamma 1
Organism
dan  Drosophila ananassae
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dan04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1640 aa AA seqDB search
MKRSRWSHSGSSTARLLIAGLLVATCSPLALGAQRQPITSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLRIESTNTCGEQGDNHFCIQTMNQNHKNCEFCRYNDHNPSFLT
DLHDPQNPTWWQSETMLEGIQHPNFVNLTLHLKKSYDITYVRILFRSPRPESFTIYKRTT
ENGPWIPYQYYSASCRDIYSLPDSRDIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSLELQDWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARCK
CNGHASKCVASTGMHGERNLVCECRHNTDGPDCDRCLPLYNDVKWKRATSTEVNECKACN
CNGLADKCFFDAHLFNLTGHGGHCLDCRENRDGPNCERCKENFYMREDGYCVNCACDPTG
SRSLQCNSQGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQPCGCDSRGSHENTPACDAVTG
ICICKENVEGRRCNECKPGFFNLDKINRFGCTPCFCYGHTSECQTAPGYSIVSVTSNFNK
FKERWTAIDLNRREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVGPSTSASDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHENHDYQWQPSQS
ARGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGNPATWIEQCTCPEGYLGQ
FCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFY
GNALGGTPYDCKRCPCPNEGACLQINGDTVICTECPVGYFGSRCEQCSDGFFGDPTGLLG
AVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDLCLPGHFGDPLALPHGSC
DRCSCYEAGTEQDEQSISRCDQVTGQCQCKPNVIGKDCGECQPGYFNIRSGNGCENCLCD
PVGSYNSTCDRHTGQCHCRPGVVGKKCDQCANYFYGFSNEGCLPCECDESGSKGFQCDQY
GQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLTNLSQTLDEIA
RTPVTNDEEFEAKLRAVQEKVAVLSQDARDNAGEGGQTYSEVIDDLHKRLDGVKEHLASA
TKHQEEANAEIEKSRHNYTILDQITENAKKELQEALDLLSDEGEKALAKAKEKSVEFGQQ
SEQISEISREARALAIKLESEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQQDIAKVLRSE
VNLEMNHVNQSLRTVVQIAKEALEKANQVYDTALTLLNDVNRQTQPEIDINELKKDAVAA
NERADELLKRINDLSNSNGEIFADFHEERELAETLLERADKQQQEDIELLARAKAAHDKA
TEAVEQGDNTLKEANNTYNTLFGFQSDVQRSSQSADEALQTVPNIEKEIQNAEDLIRQAG
DALAGANKNANEAKQNAQEAQKKYAEQASKDAELIRRKANETKVAARNLRDEADQLNHRV
KLTEMDIFQLEESSTKDDNLVDDAKRKVGQAKADTQDAQKQIEKANAELTAIKDELENLK
DINTGDLDKLENRLAGVEGEINRVNLTGRIENYRKQRTIQKNLIDKYAAELKELSKEVES
IRVISTVLPDGCFGRNRLEP
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagccggtggagccacagtggctcctccacggcgcgtctgctaatcgccggc
ctgctggtagccacctgctcccctttagctctgggagcgcaaaggcagcccatcacctcc
gccggaggacacgagctgcgcggcaccacctttatgccggccctggagtgctacgatccc
tatggcagaccgcagaaatgtctgcccgagttcatcaatgctgcctatcaactgagaatc
gaatcgaccaatacctgtggcgaacagggtgacaatcatttttgcatccaaacaatgaat
cagaatcacaaaaactgcgagttctgcagatataacgaccacaatccttcattcctaacg
gatctgcacgacccccagaatccaacctggtggcagtcggagaccatgcttgagggtatc
cagcatcccaactttgtcaatctcactctgcatttaaaaaaatcctacgatattacgtac
gtgcgtatccttttccgttcgccgcgtcccgaatcctttacgatttacaagcgcaccacg
gagaatggaccctggattccgtatcagtactacagtgcgtcctgtcgggacatctactcc
ctgccggattcgagggacatccgtaaaggcgagggcgaggcccatgctctgtgtaccagc
gagtacagtgacatctccccactgagggacggtgagattgccttctccaccctggagggt
cgtcccagcggcatcaactttgagcgcagcttggagctgcaggattgggtcacagccacg
gatattcgtatcaccctggaccgtctgaacaccttcggagacgagctgttcggcgattct
caggtgctgaagtcgtacttctatgccattagtgatattgccgtgggagctcgttgcaag
tgtaatggacatgcaagcaagtgtgtggcaagtacgggaatgcacggagaaaggaacctg
gtgtgcgagtgtcgccacaacaccgatggccccgactgtgatcgctgtctgccactctac
aacgatgtgaaatggaagagggccacctccacggaggtcaacgagtgcaaagcttgtaac
tgcaacggtctggcggacaagtgcttcttcgatgcccatcttttcaacctgacgggtcat
ggtggtcactgtctggactgccgggagaaccgcgacggccccaactgcgagcgctgcaag
gagaacttctacatgcgggaggacggctactgcgtcaactgcgcctgtgatcctactggc
tcccggtcgctgcagtgcaacagccagggcaagtgccagtgcaagccgggagtgaccgga
gacaagtgcgaccgctgtgacaacaactattatcagtttggaccccacggatgccagccc
tgcggatgtgatagccggggatcccacgaaaacacccccgcgtgcgatgccgtgaccggt
atctgtatctgcaaagagaatgtggagggcaggcgctgcaatgaatgcaagcctggcttc
ttcaacctggacaagatcaaccgcttcggctgcactccctgcttctgctacggccatacc
tccgagtgtcagactgcccccggctactccattgtgtctgtgacctccaacttcaacaag
ttcaaggagcgctggacagccattgacctgaaccgccgcgaggtggacatcaagtacaac
cagtacagccggagcattggcaccaccgcccagggcaacgagcacgtatacttccaggcc
ccggacagattccttggcgatcagcgtgcctcttacaatcgcgacctcaagttcaagctg
cagttagtgggacaggtgggccccagtaccagtgccagcgatgtgatcctcgagggtgcc
ggaagtcgcatctcactacccatctttgcccagggcaacggaattcccgaccagggagtg
aaggagtatactttccggctgcacgaaaaccacgactaccaatggcagcctagccagtcg
gctcgtggattcctctccattctgtccaatctgactgctatcaagattagggccacgtat
tcggtgcagggcgaggccatcctggacgatgtggagcttcagacggcgcatcgtggagca
gccggcaacccggccacctggatcgagcagtgtacctgtccggagggctacctgggacag
ttttgcgagtcctgcgctcctggctatcgtcacagcccagcccgaggaggaccctttatg
ccatgtatcccctgcgactgccacggtcatgccgatatctgtgactcggagacgggtcgc
tgcatctgccagcacaacacccacggcgataactgcgaccagtgcgccaagggtttctac
ggcaatgctctcggaggcactccctatgactgcaagcgctgtccttgccccaatgaagga
gcttgtctgcaaatcaatggtgacacggtgatctgcacagagtgtcctgtcggttacttc
ggctcccgctgcgaacagtgtagtgatggcttcttcggcgatccgacgggactccttggg
gccgtgcaaacctgcaagagctgcgactgcaacggtaatgtggatcccaatgctgtgggc
aactgcaatcgaactaccggcgagtgcttgaagtgtatccacaacacggccggagagcac
tgcgatctgtgtctgccaggacactttggcgatcccttggccctgccccacggaagctgt
gatcggtgcagctgctacgaggctggaacagagcaggatgagcagagcatctcccgttgc
gaccaggtcaccggccagtgccaatgcaagcccaacgtaatcggcaaggattgcggtgag
tgccagccaggctacttcaacatccgatcgggcaatggctgcgagaactgtctctgcgat
ccagtgggcagctacaactctacctgcgacaggcacaccggccagtgccactgccgaccc
ggagtggtgggcaagaagtgcgatcagtgcgccaactacttctacggcttctccaacgag
ggctgcctgccctgcgagtgcgacgagagcggctccaagggcttccagtgcgaccaatac
ggccagtgtccttgcaacgacaatgtcgaaggacgacgatgcgaccgctgcaaggagaac
aaatacgatcgccatcggggctgcatcgactgcccggactgctacaatctggttcaggat
gccgccgatctgcaccgcgccaagctgactaatctcagccagaccctggacgagattgct
cgcactccggtgaccaatgacgaggagtttgaggccaagctgcgggctgtccaagagaag
gtggccgtgctgtcgcaagatgcccgggataatgctggcgaaggtggtcagacctattcc
gaggtgattgacgatctgcacaagcgcctagatggagtcaaggagcacctggccagcgcc
accaagcaccaggaagaagctaacgccgagatcgaaaagtcacgacacaattacaccatc
ctggaccagatcacggagaacgccaagaaggagctgcaggaggccctggatcttctcagc
gacgagggtgaaaaggccttggctaaggccaaggagaagtccgtggaatttggccagcag
tcggagcagatatccgaaatctcccgggaggctcgtgccttggccatcaaactggaatcg
gaggcgcaattcgatctgaagaatgccaaggacgcaaaggatgcggtggagaaggcccat
cagctggccaagagtgccattgacctgcaacaggatattgccaaggtgctgcgctccgag
gtcaatctggaaatgaatcatgttaaccagtcgctgcgcaccgtggtccagatcgccaag
gaggccttggaaaaggccaaccaggtgtacgacacggccttgactcttcttaatgacgtg
aaccgacagacccagccggaaatcgacatcaatgagctgaagaaggatgcagtggctgcc
aacgaaagggccgatgagctgctcaagaggatcaacgatttgtccaacagcaatggtgag
atattcgccgatttccatgaagagcgcgaactggcagagacactccttgaaagagccgac
aagcagcagcaggaggacattgagctactggcgagagccaaggctgctcacgacaaggcc
accgaggccgtggagcaaggagacaataccctcaaggaggccaataacacatacaataca
ctctttggtttccagtcggatgtgcagcgctcctcgcagagtgcagacgaagccctgcag
acagtgcccaatatcgagaaggaaattcagaatgcggaggatctgatccggcaggctgga
gatgctttggcaggagctaacaagaatgccaacgaagccaagcaaaatgcccaggaagca
cagaagaagtacgccgaacaggcatccaaggatgcggagcttatccgtcgcaaggccaac
gagaccaaggttgctgccaggaatctgcgagatgaggctgatcagctcaaccatcgggtg
aagcttaccgaaatggacatcttccagctggaggaaagctccaccaaggacgacaatctg
gtggacgatgccaagcgcaaggtgggccaagccaaggccgatacccaagacgctcagaag
caaatcgaaaaggctaacgccgagctgacggccatcaaggacgagttggagaacctgaag
gacatcaacactggtgatttagataaattggagaaccgcctggccggtgtagagggtgaa
atcaatcgcgtcaatctgacaggacgcattgaaaactacagaaagcaacgcaccatccag
aagaatctgatcgataaatacgctgccgagctgaaggagctgtccaaggaggtggaaagc
atcagggtcatatccacggtcctgccagatggctgctttggacgcaatcgtctggagcca
tag

DBGET integrated database retrieval system