KEGG   Drosophila ananassae: Dana_GF25157Help
Entry
Dana_GF25157      CDS       T01059                                 

Definition
GF25157 gene product from transcript GF25157-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dan  Drosophila ananassae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF25157
   00052 Galactose metabolism
    Dana_GF25157
Enzymes [BR:dan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dana_GF25157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 377 aa AA seqDB search
MSITLEEEIFGLAVNPFTNHPEMVRRYTLKNSKGMSVSVIQLGAIIQSVKLPDAYEKVDD
VCLGFNDIASYIATKAAYIGGTLGRVANRVANGEYTVNENKIQVTKNIQDKFQLHGGFVG
FDSVIWEVAQKTVDGVIFRHVSPHGHEGYPGRLTCFITYQLDNENRLWVRFEATTDRSTV
VNISNHAYFNLAGHGAGAKGLSEHTVEIAADKIVDTDESQIPTGKLLDVDDTVYDLRLPV
LIGDRLRQFENRPIQGYDNCFVVNGGELVKSVTKVAKIVHPPSCRVLEVWTNQPGMQFYT
ANNLPDEKAGATPIIGKECTHYVRHGSFCVETEKFPDSMNHPEFPSINLEPDQKYCHEVL
YWFKVEESWKCCCNNAP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcaccttggaggaggagatcttcggcttagcggttaatccgttcaccaaccac
cccgaaatggtgcgccgctatactttgaagaatagtaagggcatgtccgtttcggttatc
cagctgggtgccatcattcagagtgtcaagctgccggatgcctatgagaaggtggacgac
gtctgtctcggcttcaatgacattgccagctatatagccaccaaggcggcttacatcgga
ggaacccttggacgtgtcgccaatcgagtggccaatggagagtatacagtcaacgaaaac
aagatccaagtgactaagaacatacaggacaagtttcaactgcacggtggctttgttggg
tttgacagtgtgatctgggaagtggcgcaaaagactgtggatggcgtcatcttccggcat
gtgtccccccacgggcacgagggctatccgggcagactaacgtgtttcatcacataccag
ctggacaacgagaaccgactctgggtccgcttcgaggccaccaccgatcgcagcactgtg
gtgaatatctccaaccatgcctactttaatctggccggacatggagccggagcgaagggt
ctgtcggagcacaccgtggagatagcggcagataagattgtggacaccgatgagtctcag
attcccaccggtaagctgctggatgtcgatgataccgtctatgatctgaggttgcctgtg
ctcatcggagaccgtctcaggcagttcgaaaacagacccatccagggatatgacaactgt
ttcgtggtcaatggtggagaactggtaaagagcgtcaccaaggtagccaagatcgtccat
ccgcccagttgccgtgtcctggaggtctggacgaatcagccgggcatgcagttttacact
gcaaataatctgccggatgagaaagcaggcgccacgccgataattggaaaggagtgcacc
cattatgtgcgccatgggtccttctgcgtcgaaacggaaaagttccccgactccatgaac
catcctgagtttccctcaatcaacctggagccggaccagaagtactgccacgaagttctt
tactggttcaaggtcgaagagtcctggaagtgctgctgcaacaatgctccctga

DBGET integrated database retrieval system