KEGG   Drosophila ananassae: Dana_GF25278Help
Entry
Dana_GF25278      CDS       T01059                                 

Definition
GF25278 gene product from transcript GF25278-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dan  Drosophila ananassae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF25278
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF25278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MSAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQAARDSVHGMIQKEVSAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPDAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgccggtgattgtcgaggccacggtcaaacagaccgccacgctgattttcatg
catggcttgggagacacgggtcatgggtggagcagcgctcttgccgccatccggccaccc
ttcatgaaggtcatctgccccacggcccccacacagcctgtttcgttaaatgccggcttc
aggatgccatcgtggtttgatctgaagaccctggacattggcggaccggaggacgagcct
ggcattcaggcggcgcgcgacagcgtacacgggatgattcaaaaggaggtcagtgctgga
atacccgcaaaccggatcgttctgggcggtttttcgcagggtggtgccctggcattgtat
tcggcgctgacctacgaccaaccgctggccggtgtggtggctctgtcctgttggttgccg
cttcacaagcagttccccgacgccaaggtcaacagtgatgatgtgcccatcttccaggcg
catggcgactacgatcccgtggtgccctacaaattcggccagctgagtgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacctatagtggactatcgcactcgtcgtcc
gacgacgagatggacgacgtcaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system