KEGG   Drosophila ananassae: Dana_GF25295Help
Entry
Dana_GF25295      CDS       T01059                                 

Definition
GF25295 gene product from transcript GF25295-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dan  Drosophila ananassae
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dan00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 313 aa AA seqDB search
MTEFDFVPIAVGVVAVVAGALIVHYFLNRKSTKPRREPNRTARLRTLVDPNDKYLLPLVE
KEVLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYVDLV
VKVYFKDSHPKFPAGGKMTQHLEKMELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKN
VNAKRVNMIAGGTGITPMLQLVREVLKRSDKDKTELALLFANQSEKDILLRDELDELAQK
HPEQFKVWYTVDKAAEGWPYSVGFINEDMIAAHLLPASDDTIVLLCGPPPMINFACNPAL
DKLGYHPDTRFAY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattcgattttgtgcctatcgccgtgggcgtggttgccgtagtcgccggcgcc
ctcatcgtccactatttcctgaacaggaagtccaccaaaccccgccgggaacccaatcgc
accgcccgtctccgcactctggtggatcccaacgacaaatacctgctgcccctcgtggag
aaggaggtgctcagccacgatacccgacgattccgcttcggattgccctccaagcagcat
gtccttggcctgccggtgggtcagcacatccatctgatcgccaccattgacaacgaactg
gtgatccgtccgtatacgcccatctcgtcggacgaagatgtcggctacgtggatctggtg
gtcaaggtctacttcaaggactcgcatcccaagttcccggccggcggcaagatgacccag
catttggagaaaatggaactgggagataagatctccttccgtggtccctccggacggctg
cagtacctcggcaacggcaccttctccatcaagaagctgcgcaaggatccgcccaagaat
gtcaacgccaagcgggtgaacatgattgccggcggcactggcatcactcccatgctgcag
ttggtccgcgaggtcctcaagcgcagtgacaaggataagaccgaactggcgcttctgttt
gccaatcagagcgaaaaggacattcttctccgcgacgaactggacgaactggctcaaaag
catcccgagcagttcaaggtctggtataccgtggacaaggcggctgaaggctggccatat
agcgtgggcttcatcaacgaggacatgatcgccgcccacctcctgcccgcctcggacgac
accatcgtgctgctgtgcggcccaccgcccatgatcaactttgcctgtaatccggccctg
gacaagcttggctaccatccggacacccgattcgcctactag

DBGET integrated database retrieval system