KEGG   Drosophila ananassae: Dana_GF25295Help
Entry
Dana_GF25295      CDS       T01059                                 

Definition
GF25295 gene product from transcript GF25295-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dan  Drosophila ananassae
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF25295
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dana_GF25295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 313 aa AA seqDB search
MTEFDFVPIAVGVVAVVAGALIVHYFLNRKSTKPRREPNRTARLRTLVDPNDKYLLPLVE
KEVLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYVDLV
VKVYFKDSHPKFPAGGKMTQHLEKMELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKN
VNAKRVNMIAGGTGITPMLQLVREVLKRSDKDKTELALLFANQSEKDILLRDELDELAQK
HPEQFKVWYTVDKAAEGWPYSVGFINEDMIAAHLLPASDDTIVLLCGPPPMINFACNPAL
DKLGYHPDTRFAY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattcgattttgtgcctatcgccgtgggcgtggttgccgtagtcgccggcgcc
ctcatcgtccactatttcctgaacaggaagtccaccaaaccccgccgggaacccaatcgc
accgcccgtctccgcactctggtggatcccaacgacaaatacctgctgcccctcgtggag
aaggaggtgctcagccacgatacccgacgattccgcttcggattgccctccaagcagcat
gtccttggcctgccggtgggtcagcacatccatctgatcgccaccattgacaacgaactg
gtgatccgtccgtatacgcccatctcgtcggacgaagatgtcggctacgtggatctggtg
gtcaaggtctacttcaaggactcgcatcccaagttcccggccggcggcaagatgacccag
catttggagaaaatggaactgggagataagatctccttccgtggtccctccggacggctg
cagtacctcggcaacggcaccttctccatcaagaagctgcgcaaggatccgcccaagaat
gtcaacgccaagcgggtgaacatgattgccggcggcactggcatcactcccatgctgcag
ttggtccgcgaggtcctcaagcgcagtgacaaggataagaccgaactggcgcttctgttt
gccaatcagagcgaaaaggacattcttctccgcgacgaactggacgaactggctcaaaag
catcccgagcagttcaaggtctggtataccgtggacaaggcggctgaaggctggccatat
agcgtgggcttcatcaacgaggacatgatcgccgcccacctcctgcccgcctcggacgac
accatcgtgctgctgtgcggcccaccgcccatgatcaactttgcctgtaatccggccctg
gacaagcttggctaccatccggacacccgattcgcctactag

DBGET integrated database retrieval system