KEGG   Desulfobacca acetoxidans DSM 11109: Desac_0116Help
Entry
Desac_0116        CDS       T01454                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dao  Desulfobacca acetoxidans DSM 11109
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dao00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dao00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dao02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
140741..142183
Genome map
AA seq 480 aa AA seqDB search
MKLRKISPRLAALLAVLILLLAGSAAQAETAKNVILMISDGWGYNQVKATDYYNGSAAVF
ENFSVQYGMSTYSMGKMPKTGFLPPGTPISPVGYDTNKAWSDFNYVKSGYTDSASAATAM
ATGVKIFDNVLNMDVYGNKLKTITEYAAEQGKATGVVTSVEISHATPAGMYAHNVSRNNF
TELANEMLAGPLNVIMGAGNPRYDNNGNYLFTPNSYKYVGGEDTWNDLRTGSHTNNWSLI
ESETAFEALASASATPERVVGVAEVYETLQQSRKPAPGPNVLLDPDDDTPLNDSVPSLAL
MTKGALNVLDNDPDGFFLMIEGGAVDWANHANQLGRLIQEQSDFNDSVQVVVDWVLANGG
WDENLLIVTGDHECGYLWGPTPGVFNEVVDNGAGNLPGAYFNSGSHTNSIIPLYAEGAGS
ELFAGYADELDLVRGSYLDNTELFQVMKAQVVPTPLPGTVWLMGFGLSGLIVSGLRRWQI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacgaaagataagtccccgtcttgccgctctcctggcagtcctgattttattg
ctggccggcagcgcggcccaggcggagacggctaaaaatgtcattttaatgatttctgac
ggttggggctacaatcaggtcaaggccaccgactactacaacggctcagcggcggttttt
gagaacttcagcgtgcagtatggcatgagtacctactccatgggcaagatgcccaagacc
ggttttcttcctcccggcactcccatcagcccggtaggttatgataccaacaaggcctgg
agcgacttcaactacgtcaaatccggctatacggattcggcttcggcagccacggctatg
gccacgggcgtcaagatctttgataatgtcctcaatatggatgtctatggcaataaatta
aagacaattaccgagtatgccgccgaacaggggaaggccaccggcgtcgtcacctcggtg
gaaatcagtcacgccaccccggcggggatgtatgcccataacgtttcccgcaacaatttc
accgaactggccaacgaaatgctggctggtccgttaaacgtcatcatgggagccggtaat
ccccggtatgacaacaatggcaattatctctttacccctaattcctataaatatgtcggc
ggcgaggacacctggaatgacttgagaaccggcagtcacaccaacaattggtccttgatc
gaatccgagaccgcttttgaagctctcgccagtgcgtcagccaccccagagcgcgtggtc
ggtgtggcggaagtctatgaaaccctgcaacagtcccggaaaccagcgcccggacctaat
gttctgttagatcccgacgatgacacgccactgaatgattcggtgccgagcctggcgctc
atgaccaaaggggccctgaatgtgctggataacgatcctgacggtttcttccttatgatt
gagggcggtgcggtagattgggccaaccatgccaaccaattgggccgcctgatccaggag
cagagcgattttaacgactcagtgcaagtggttgtcgactgggtactggcgaacggtggt
tgggacgagaacctgctgattgtcactggcgaccatgagtgcggatacctctggggtccg
acaccgggggtcttcaatgaagtggtagataatggtgccggtaacctgccaggggcttat
ttcaattccggcagtcataccaacagcatcattccgctttatgccgaaggcgccggctcc
gaattgtttgctggctacgccgatgagctggatctggtccggggatcatatctggacaat
actgaattgttccaggtcatgaaggcccaggtagtcccgacgccactgccagggaccgtc
tggctgatgggatttggcctgagtggattgattgtctctggcctgcggagatggcaaatc
taa

DBGET integrated database retrieval system